BLASTX nr result
ID: Forsythia22_contig00031530
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00031530 (285 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011093871.1| PREDICTED: ethylene-responsive transcription... 67 4e-09 >ref|XP_011093871.1| PREDICTED: ethylene-responsive transcription factor ERF017-like [Sesamum indicum] Length = 224 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/53 (58%), Positives = 40/53 (75%), Gaps = 4/53 (7%) Frame = -2 Query: 269 FFAIGTENNVLDYGIFPGFDDF----LALPLPSLDNWPDNSDGVSSEDSFLWN 123 F ++GTENNV D+G+FPGFDDF +A LPS D +PDN++ S+DSFLWN Sbjct: 171 FLSMGTENNVPDFGLFPGFDDFPGDYMAPLLPSADYYPDNNEEFPSQDSFLWN 223