BLASTX nr result
ID: Forsythia22_contig00031143
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00031143 (394 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP11453.1| unnamed protein product [Coffea canephora] 58 3e-06 ref|XP_011100644.1| PREDICTED: type I inositol 1,4,5-trisphospha... 57 6e-06 >emb|CDP11453.1| unnamed protein product [Coffea canephora] Length = 699 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/55 (52%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Frame = -3 Query: 164 FFTNFP-FISYYFPFRLSVNMRKQNTRHQHQKSETSWAEKLCFGCTCLQLFWGRV 3 F N P F ++ F MR+ +TR Q Q+ WAE LCFGCTCLQLFWGRV Sbjct: 19 FLQNLPTFFKFFIQF---FKMRQSSTRRQQQRG---WAEILCFGCTCLQLFWGRV 67 >ref|XP_011100644.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1-like isoform X1 [Sesamum indicum] gi|747046648|ref|XP_011100647.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1-like isoform X1 [Sesamum indicum] Length = 664 Score = 56.6 bits (135), Expect = 6e-06 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = -3 Query: 107 MRKQNTRHQHQKSETSWAEKLCFGCTCLQLFWGRV 3 M+K+N R+ HQ++E +WAE LCFGC CLQL W RV Sbjct: 1 MKKENVRNHHQQTERNWAEILCFGCACLQLSWRRV 35