BLASTX nr result
ID: Forsythia22_contig00031037
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00031037 (414 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011070322.1| PREDICTED: uncharacterized protein LOC105156... 61 3e-07 ref|XP_012842170.1| PREDICTED: uncharacterized protein LOC105962... 56 8e-06 >ref|XP_011070322.1| PREDICTED: uncharacterized protein LOC105156007 [Sesamum indicum] Length = 142 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 314 TMMRYFSSSSRKRAPNLRKINPKVSFQEAASIA 412 TMMRYFSSSSRKRAPNLRKINP+V FQEAA IA Sbjct: 15 TMMRYFSSSSRKRAPNLRKINPRVPFQEAAVIA 47 >ref|XP_012842170.1| PREDICTED: uncharacterized protein LOC105962409 [Erythranthe guttatus] gi|604327676|gb|EYU33423.1| hypothetical protein MIMGU_mgv1a015750mg [Erythranthe guttata] Length = 147 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +2 Query: 314 TMMRYFSSSSRKRAPNLRKINPKVSFQEAASIA 412 TM+RYF+++SRKRAPNLRKINP+V F EAASIA Sbjct: 15 TMLRYFTTNSRKRAPNLRKINPRVPFVEAASIA 47