BLASTX nr result
ID: Forsythia22_contig00030166
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00030166 (217 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098409.1| PREDICTED: uncharacterized protein LOC105177... 63 9e-08 >ref|XP_011098409.1| PREDICTED: uncharacterized protein LOC105177084 [Sesamum indicum] Length = 931 Score = 62.8 bits (151), Expect = 9e-08 Identities = 32/73 (43%), Positives = 49/73 (67%), Gaps = 2/73 (2%) Frame = -2 Query: 216 AWGNAVPLFVGNEIYDQSGVVI-VDSIETSEVGFGTISEADKK-NNGPLNISYKLSFNPF 43 AWG+AVP+ VG+++Y+ +++ VDS+ + GF ISE + N GPLNISY++S NP+ Sbjct: 466 AWGSAVPVSVGDQLYETRNMLVAVDSVAFAP-GFAAISEPEMSANKGPLNISYRISINPY 524 Query: 42 PQEKLGGWFSPLN 4 P+ + F LN Sbjct: 525 PEVESSDLFRALN 537