BLASTX nr result
ID: Forsythia22_contig00030143
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00030143 (312 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009412716.1| PREDICTED: thioredoxin F1, chloroplastic-lik... 96 7e-18 ref|XP_012834629.1| PREDICTED: thioredoxin F1, chloroplastic-lik... 96 1e-17 ref|XP_011077155.1| PREDICTED: thioredoxin F1, chloroplastic-lik... 96 1e-17 ref|XP_012085778.1| PREDICTED: thioredoxin F-type, chloroplastic... 96 1e-17 ref|XP_010246376.1| PREDICTED: thioredoxin F-type, chloroplastic... 94 3e-17 gb|AFK48258.1| unknown [Lotus japonicus] 94 3e-17 gb|AFK37418.1| unknown [Lotus japonicus] 94 3e-17 ref|XP_010500707.1| PREDICTED: thioredoxin F1, chloroplastic-lik... 94 4e-17 ref|XP_007139716.1| hypothetical protein PHAVU_008G053300g [Phas... 94 4e-17 ref|XP_004492848.1| PREDICTED: thioredoxin F-type, chloroplastic... 94 4e-17 ref|XP_010485595.1| PREDICTED: thioredoxin F1, chloroplastic-lik... 93 6e-17 ref|XP_010463696.1| PREDICTED: thioredoxin F1, chloroplastic [Ca... 93 6e-17 ref|XP_010451256.1| PREDICTED: thioredoxin F1, chloroplastic-lik... 93 6e-17 gb|ACJ83989.1| unknown [Medicago truncatula] gi|388514077|gb|AFK... 93 6e-17 ref|XP_006298548.1| hypothetical protein CARUB_v10014629mg, part... 93 6e-17 ref|XP_003624192.1| Thioredoxin [Medicago truncatula] gi|3554992... 93 6e-17 gb|KHN29261.1| Thioredoxin F-type, chloroplastic [Glycine soja] 92 1e-16 ref|XP_008787736.1| PREDICTED: thioredoxin F, chloroplastic-like... 92 1e-16 ref|XP_010525093.1| PREDICTED: thioredoxin F1, chloroplastic-lik... 92 1e-16 ref|XP_008366893.1| PREDICTED: thioredoxin F-type, chloroplastic... 92 1e-16 >ref|XP_009412716.1| PREDICTED: thioredoxin F1, chloroplastic-like [Musa acuminata subsp. malaccensis] Length = 179 Score = 96.3 bits (238), Expect = 7e-18 Identities = 46/53 (86%), Positives = 50/53 (94%) Frame = -3 Query: 310 KLDCNQENRPLAKELGLKVVPTFKILKDSKVLKEVTGAKYDDLVVAIENARAS 152 KLDCNQENRPLAKELG+KVVPTFKILKD KV+KEVTGAKYDDLVVAIE ++S Sbjct: 127 KLDCNQENRPLAKELGIKVVPTFKILKDGKVVKEVTGAKYDDLVVAIETTKSS 179 >ref|XP_012834629.1| PREDICTED: thioredoxin F1, chloroplastic-like [Erythranthe guttatus] Length = 175 Score = 95.5 bits (236), Expect = 1e-17 Identities = 46/52 (88%), Positives = 50/52 (96%) Frame = -3 Query: 310 KLDCNQENRPLAKELGLKVVPTFKILKDSKVLKEVTGAKYDDLVVAIENARA 155 KLDCN +NRPLAKELGLKVVPTFKILKDSK++KEVTGAK DDLVVAIENAR+ Sbjct: 123 KLDCNNDNRPLAKELGLKVVPTFKILKDSKIVKEVTGAKLDDLVVAIENARS 174 >ref|XP_011077155.1| PREDICTED: thioredoxin F1, chloroplastic-like [Sesamum indicum] Length = 175 Score = 95.5 bits (236), Expect = 1e-17 Identities = 44/53 (83%), Positives = 51/53 (96%) Frame = -3 Query: 310 KLDCNQENRPLAKELGLKVVPTFKILKDSKVLKEVTGAKYDDLVVAIENARAS 152 KLDCNQEN+PLAKELG+KVVPTFKILKD+K++KEVTGAKYDDLV AIE AR++ Sbjct: 123 KLDCNQENKPLAKELGIKVVPTFKILKDNKIIKEVTGAKYDDLVAAIETARST 175 >ref|XP_012085778.1| PREDICTED: thioredoxin F-type, chloroplastic [Jatropha curcas] gi|643714216|gb|KDP26881.1| hypothetical protein JCGZ_18039 [Jatropha curcas] Length = 186 Score = 95.5 bits (236), Expect = 1e-17 Identities = 46/53 (86%), Positives = 50/53 (94%) Frame = -3 Query: 310 KLDCNQENRPLAKELGLKVVPTFKILKDSKVLKEVTGAKYDDLVVAIENARAS 152 KLDCNQEN+PLAKELG+KVVPTFKILKDSKV+KEVTGAKYDDLV AIE R+S Sbjct: 134 KLDCNQENKPLAKELGIKVVPTFKILKDSKVVKEVTGAKYDDLVAAIEAVRSS 186 >ref|XP_010246376.1| PREDICTED: thioredoxin F-type, chloroplastic-like [Nelumbo nucifera] Length = 179 Score = 94.4 bits (233), Expect = 3e-17 Identities = 44/53 (83%), Positives = 51/53 (96%) Frame = -3 Query: 310 KLDCNQENRPLAKELGLKVVPTFKILKDSKVLKEVTGAKYDDLVVAIENARAS 152 KLDCNQENRPLAKELG++VVPTFKILKD KV+KEVTGAK+DDLV AIE+A++S Sbjct: 127 KLDCNQENRPLAKELGIRVVPTFKILKDGKVIKEVTGAKFDDLVAAIESAKSS 179 >gb|AFK48258.1| unknown [Lotus japonicus] Length = 179 Score = 94.4 bits (233), Expect = 3e-17 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = -3 Query: 310 KLDCNQENRPLAKELGLKVVPTFKILKDSKVLKEVTGAKYDDLVVAIENARAS 152 KLDCNQ+N+PLAKELG+KVVPTFKILKDSK++KE+TGAKYDDLV AIE R+S Sbjct: 127 KLDCNQDNKPLAKELGIKVVPTFKILKDSKIVKEITGAKYDDLVAAIETVRSS 179 >gb|AFK37418.1| unknown [Lotus japonicus] Length = 179 Score = 94.4 bits (233), Expect = 3e-17 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = -3 Query: 310 KLDCNQENRPLAKELGLKVVPTFKILKDSKVLKEVTGAKYDDLVVAIENARAS 152 KLDCNQ+N+PLAKELG+KVVPTFKILKDSK++KE+TGAKYDDLV AIE R+S Sbjct: 127 KLDCNQDNKPLAKELGIKVVPTFKILKDSKIVKEITGAKYDDLVAAIETVRSS 179 >ref|XP_010500707.1| PREDICTED: thioredoxin F1, chloroplastic-like [Camelina sativa] Length = 183 Score = 94.0 bits (232), Expect = 4e-17 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = -3 Query: 310 KLDCNQENRPLAKELGLKVVPTFKILKDSKVLKEVTGAKYDDLVVAIENARAS 152 KLDCN +NRPLAKELGL+VVPTFKILKD+KV+KEVTGAKYDDLV AIE AR+S Sbjct: 126 KLDCNPDNRPLAKELGLRVVPTFKILKDNKVVKEVTGAKYDDLVAAIETARSS 178 >ref|XP_007139716.1| hypothetical protein PHAVU_008G053300g [Phaseolus vulgaris] gi|561012849|gb|ESW11710.1| hypothetical protein PHAVU_008G053300g [Phaseolus vulgaris] Length = 181 Score = 94.0 bits (232), Expect = 4e-17 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = -3 Query: 310 KLDCNQENRPLAKELGLKVVPTFKILKDSKVLKEVTGAKYDDLVVAIENARAS 152 KLDCNQ+NRPLAKELG+KVVPTFKILKD+KV+KEVTGAK+DDLV AI+N R S Sbjct: 129 KLDCNQDNRPLAKELGIKVVPTFKILKDNKVVKEVTGAKFDDLVAAIDNVRLS 181 >ref|XP_004492848.1| PREDICTED: thioredoxin F-type, chloroplastic-like [Cicer arietinum] Length = 181 Score = 94.0 bits (232), Expect = 4e-17 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = -3 Query: 310 KLDCNQENRPLAKELGLKVVPTFKILKDSKVLKEVTGAKYDDLVVAIENARAS 152 KLDCNQ+N+PLAKELGLKVVPTFKILKDSKV+KEVTGAKYDDLV AI R+S Sbjct: 129 KLDCNQDNKPLAKELGLKVVPTFKILKDSKVVKEVTGAKYDDLVAAINTVRSS 181 >ref|XP_010485595.1| PREDICTED: thioredoxin F1, chloroplastic-like [Camelina sativa] Length = 183 Score = 93.2 bits (230), Expect = 6e-17 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = -3 Query: 310 KLDCNQENRPLAKELGLKVVPTFKILKDSKVLKEVTGAKYDDLVVAIENARAS 152 KLDCN +NRPLAKELG++VVPTFKILKD+KV+KEVTGAKYDDLV AIE AR+S Sbjct: 126 KLDCNPDNRPLAKELGIRVVPTFKILKDNKVVKEVTGAKYDDLVAAIETARSS 178 >ref|XP_010463696.1| PREDICTED: thioredoxin F1, chloroplastic [Camelina sativa] Length = 183 Score = 93.2 bits (230), Expect = 6e-17 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = -3 Query: 310 KLDCNQENRPLAKELGLKVVPTFKILKDSKVLKEVTGAKYDDLVVAIENARAS 152 KLDCN +NRPLAKELG++VVPTFKILKD+KV+KEVTGAKYDDLV AIE AR+S Sbjct: 126 KLDCNPDNRPLAKELGIRVVPTFKILKDNKVVKEVTGAKYDDLVAAIETARSS 178 >ref|XP_010451256.1| PREDICTED: thioredoxin F1, chloroplastic-like [Camelina sativa] Length = 93 Score = 93.2 bits (230), Expect = 6e-17 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = -3 Query: 310 KLDCNQENRPLAKELGLKVVPTFKILKDSKVLKEVTGAKYDDLVVAIENARAS 152 KLDCN +NRPLAKELG++VVPTFKILKD+KV+KEVTGAKYDDLV AIE AR+S Sbjct: 36 KLDCNPDNRPLAKELGIRVVPTFKILKDNKVVKEVTGAKYDDLVAAIETARSS 88 >gb|ACJ83989.1| unknown [Medicago truncatula] gi|388514077|gb|AFK45100.1| unknown [Medicago truncatula] Length = 186 Score = 93.2 bits (230), Expect = 6e-17 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = -3 Query: 310 KLDCNQENRPLAKELGLKVVPTFKILKDSKVLKEVTGAKYDDLVVAIENARAS 152 KLDCNQ+N+PLAKELG+KVVPTFKILKDSK++KEVTGAKYDDLV AI+ R+S Sbjct: 134 KLDCNQDNKPLAKELGIKVVPTFKILKDSKIVKEVTGAKYDDLVFAIDTVRSS 186 >ref|XP_006298548.1| hypothetical protein CARUB_v10014629mg, partial [Capsella rubella] gi|482567257|gb|EOA31446.1| hypothetical protein CARUB_v10014629mg, partial [Capsella rubella] Length = 209 Score = 93.2 bits (230), Expect = 6e-17 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = -3 Query: 310 KLDCNQENRPLAKELGLKVVPTFKILKDSKVLKEVTGAKYDDLVVAIENARAS 152 KLDCN +NRPLAKELG++VVPTFKILKD+KV+KEVTGAKYDDLV AIE AR+S Sbjct: 153 KLDCNPDNRPLAKELGIRVVPTFKILKDNKVVKEVTGAKYDDLVAAIETARSS 205 >ref|XP_003624192.1| Thioredoxin [Medicago truncatula] gi|355499207|gb|AES80410.1| thioredoxin [Medicago truncatula] Length = 182 Score = 93.2 bits (230), Expect = 6e-17 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = -3 Query: 310 KLDCNQENRPLAKELGLKVVPTFKILKDSKVLKEVTGAKYDDLVVAIENARAS 152 KLDCNQ+N+PLAKELG+KVVPTFKILKDSK++KEVTGAKYDDLV AI+ R+S Sbjct: 130 KLDCNQDNKPLAKELGIKVVPTFKILKDSKIVKEVTGAKYDDLVFAIDTVRSS 182 >gb|KHN29261.1| Thioredoxin F-type, chloroplastic [Glycine soja] Length = 181 Score = 92.4 bits (228), Expect = 1e-16 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -3 Query: 310 KLDCNQENRPLAKELGLKVVPTFKILKDSKVLKEVTGAKYDDLVVAIENARAS 152 KLDCNQENRPLAKELG+K VPTFKILKD+KV+KEVTGAKYDDLV AI+ R+S Sbjct: 129 KLDCNQENRPLAKELGIKAVPTFKILKDNKVVKEVTGAKYDDLVDAIDKVRSS 181 >ref|XP_008787736.1| PREDICTED: thioredoxin F, chloroplastic-like [Phoenix dactylifera] Length = 185 Score = 92.4 bits (228), Expect = 1e-16 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = -3 Query: 310 KLDCNQENRPLAKELGLKVVPTFKILKDSKVLKEVTGAKYDDLVVAIENARAS 152 +LDCNQENRPLAKELG++VVPTFKILKDSKV+KEVTGAK DDLV AIE A++S Sbjct: 133 RLDCNQENRPLAKELGIRVVPTFKILKDSKVVKEVTGAKLDDLVAAIETAKSS 185 >ref|XP_010525093.1| PREDICTED: thioredoxin F1, chloroplastic-like [Tarenaya hassleriana] Length = 180 Score = 92.0 bits (227), Expect = 1e-16 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -3 Query: 310 KLDCNQENRPLAKELGLKVVPTFKILKDSKVLKEVTGAKYDDLVVAIENARAS 152 KLDCNQENRPLAKELG++VVPTFKILKD K+ KEVTGAKY+DLV AIE AR+S Sbjct: 128 KLDCNQENRPLAKELGIRVVPTFKILKDGKIEKEVTGAKYEDLVAAIEAARSS 180 >ref|XP_008366893.1| PREDICTED: thioredoxin F-type, chloroplastic-like [Malus domestica] Length = 190 Score = 92.0 bits (227), Expect = 1e-16 Identities = 43/53 (81%), Positives = 51/53 (96%) Frame = -3 Query: 310 KLDCNQENRPLAKELGLKVVPTFKILKDSKVLKEVTGAKYDDLVVAIENARAS 152 KLDCNQEN+PLAKELG++VVPTFKILKD+KV+KEVTGAK+DDLVVAI+ R+S Sbjct: 138 KLDCNQENKPLAKELGIRVVPTFKILKDNKVVKEVTGAKFDDLVVAIDAVRSS 190