BLASTX nr result
ID: Forsythia22_contig00029757
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00029757 (577 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011070033.1| PREDICTED: cytochrome c oxidase subunit 5C-2... 71 4e-10 ref|XP_012839568.1| PREDICTED: probable cytochrome c oxidase sub... 69 1e-09 ref|XP_012857474.1| PREDICTED: probable cytochrome c oxidase sub... 69 1e-09 ref|XP_011079230.1| PREDICTED: probable cytochrome c oxidase sub... 68 3e-09 ref|XP_009382494.1| PREDICTED: probable cytochrome c oxidase sub... 67 7e-09 ref|XP_006402379.1| hypothetical protein EUTSA_v10006359mg [Eutr... 66 1e-08 ref|XP_006397931.1| hypothetical protein EUTSA_v10001714mg [Eutr... 66 1e-08 ref|XP_009133811.1| PREDICTED: probable cytochrome c oxidase sub... 66 1e-08 emb|CDY27493.1| BnaC04g51340D [Brassica napus] 65 2e-08 ref|XP_010261730.1| PREDICTED: cytochrome c oxidase subunit 5C-l... 65 2e-08 ref|XP_009384427.1| PREDICTED: cytochrome c oxidase subunit 5C [... 65 2e-08 ref|XP_008386720.1| PREDICTED: probable cytochrome c oxidase sub... 65 2e-08 ref|XP_002515282.1| Cytochrome c oxidase polypeptide Vc, putativ... 65 2e-08 ref|XP_006292157.1| hypothetical protein CARUB_v10018363mg [Caps... 65 2e-08 ref|XP_008797451.1| PREDICTED: cytochrome c oxidase subunit 5C-l... 65 3e-08 ref|NP_182260.1| cytochrome c oxidase subunit Vc family protein ... 65 3e-08 ref|XP_002880298.1| cytochrome c oxidase subunit VC family prote... 65 3e-08 ref|XP_002862722.1| cytochrome c oxidase subunit VC family prote... 65 3e-08 ref|XP_010931748.1| PREDICTED: cytochrome c oxidase subunit 5C-l... 64 5e-08 ref|XP_012474986.1| PREDICTED: cytochrome c oxidase subunit 5C [... 64 5e-08 >ref|XP_011070033.1| PREDICTED: cytochrome c oxidase subunit 5C-2-like [Sesamum indicum] gi|747048079|ref|XP_011070034.1| PREDICTED: cytochrome c oxidase subunit 5C-2-like [Sesamum indicum] gi|747048081|ref|XP_011070035.1| PREDICTED: cytochrome c oxidase subunit 5C-2-like [Sesamum indicum] Length = 63 Score = 70.9 bits (172), Expect = 4e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 545 LWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 450 +WKMHHWNEQRKVRAFYDLLDKGEITVVAAEE Sbjct: 32 VWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 63 >ref|XP_012839568.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Erythranthe guttatus] gi|848878286|ref|XP_012839569.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Erythranthe guttatus] gi|604330690|gb|EYU35673.1| hypothetical protein MIMGU_mgv1a017603mg [Erythranthe guttata] Length = 64 Score = 68.9 bits (167), Expect = 1e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -3 Query: 545 LWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 450 +WKMHHWNEQRKVR+FYD+LDKGEITVVAAEE Sbjct: 33 VWKMHHWNEQRKVRSFYDMLDKGEITVVAAEE 64 >ref|XP_012857474.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Erythranthe guttatus] gi|604301123|gb|EYU20843.1| hypothetical protein MIMGU_mgv1a017612mg [Erythranthe guttata] Length = 64 Score = 68.9 bits (167), Expect = 1e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -3 Query: 545 LWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 450 +WKMHHWNEQRKVR+FYD+LDKGEITVVAAEE Sbjct: 33 VWKMHHWNEQRKVRSFYDMLDKGEITVVAAEE 64 >ref|XP_011079230.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Sesamum indicum] Length = 64 Score = 68.2 bits (165), Expect = 3e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -3 Query: 545 LWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 450 +WKMHHWNEQRKVRAFYDLLDKGEI+VVAAE+ Sbjct: 33 VWKMHHWNEQRKVRAFYDLLDKGEISVVAAEQ 64 >ref|XP_009382494.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Musa acuminata subsp. malaccensis] Length = 64 Score = 66.6 bits (161), Expect = 7e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 545 LWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 450 LWKMHHWNEQRK RAFYD+L+KGEI+VVAAEE Sbjct: 33 LWKMHHWNEQRKTRAFYDMLEKGEISVVAAEE 64 >ref|XP_006402379.1| hypothetical protein EUTSA_v10006359mg [Eutrema salsugineum] gi|557103478|gb|ESQ43832.1| hypothetical protein EUTSA_v10006359mg [Eutrema salsugineum] Length = 64 Score = 66.2 bits (160), Expect = 1e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 545 LWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 450 LWKMHHWNEQRK RAFYDLL++GEI+VVAAEE Sbjct: 33 LWKMHHWNEQRKTRAFYDLLERGEISVVAAEE 64 >ref|XP_006397931.1| hypothetical protein EUTSA_v10001714mg [Eutrema salsugineum] gi|567166811|ref|XP_006397932.1| hypothetical protein EUTSA_v10001714mg [Eutrema salsugineum] gi|567166814|ref|XP_006397933.1| hypothetical protein EUTSA_v10001714mg [Eutrema salsugineum] gi|557099004|gb|ESQ39384.1| hypothetical protein EUTSA_v10001714mg [Eutrema salsugineum] gi|557099005|gb|ESQ39385.1| hypothetical protein EUTSA_v10001714mg [Eutrema salsugineum] gi|557099006|gb|ESQ39386.1| hypothetical protein EUTSA_v10001714mg [Eutrema salsugineum] Length = 64 Score = 66.2 bits (160), Expect = 1e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 545 LWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 450 LWKMHHWNEQRK RAFYDLL++GEI+VVAAEE Sbjct: 33 LWKMHHWNEQRKTRAFYDLLERGEISVVAAEE 64 >ref|XP_009133811.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Brassica rapa] gi|674895068|emb|CDY37800.1| BnaC04g00250D [Brassica napus] gi|674937787|emb|CDX95722.1| BnaC03g26030D [Brassica napus] gi|674950141|emb|CDX83330.1| BnaA03g21760D [Brassica napus] Length = 64 Score = 65.9 bits (159), Expect = 1e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 545 LWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 450 LWKMHHWNEQRK RAFYDLL++GEI+V+AAEE Sbjct: 33 LWKMHHWNEQRKTRAFYDLLERGEISVIAAEE 64 >emb|CDY27493.1| BnaC04g51340D [Brassica napus] Length = 116 Score = 65.5 bits (158), Expect = 2e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 545 LWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 450 LWKMHHWNEQRK RAFYDLL++GEI V+AAEE Sbjct: 85 LWKMHHWNEQRKTRAFYDLLERGEINVIAAEE 116 >ref|XP_010261730.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Nelumbo nucifera] Length = 63 Score = 65.1 bits (157), Expect = 2e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 545 LWKMHHWNEQRKVRAFYDLLDKGEITVVAAE 453 +WKMHHWNEQRKVRAFYD+LDKGEI+VVA E Sbjct: 33 MWKMHHWNEQRKVRAFYDMLDKGEISVVAEE 63 >ref|XP_009384427.1| PREDICTED: cytochrome c oxidase subunit 5C [Musa acuminata subsp. malaccensis] gi|695074450|ref|XP_009384428.1| PREDICTED: cytochrome c oxidase subunit 5C [Musa acuminata subsp. malaccensis] Length = 64 Score = 65.1 bits (157), Expect = 2e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 545 LWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 450 LWKMHHWNEQRK RAFYD+L+KGEI+VV AEE Sbjct: 33 LWKMHHWNEQRKTRAFYDMLEKGEISVVVAEE 64 >ref|XP_008386720.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Malus domestica] Length = 63 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 545 LWKMHHWNEQRKVRAFYDLLDKGEITVVAAE 453 LWKMHHWNEQRKVRAFYDLL+KGEI+VVA E Sbjct: 33 LWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 63 >ref|XP_002515282.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis] gi|255559374|ref|XP_002520707.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis] gi|223540092|gb|EEF41669.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis] gi|223545762|gb|EEF47266.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis] Length = 63 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 545 LWKMHHWNEQRKVRAFYDLLDKGEITVVAAE 453 LWKMHHWNEQRKVRAFYDLL+KGEI+VVA E Sbjct: 33 LWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 63 >ref|XP_006292157.1| hypothetical protein CARUB_v10018363mg [Capsella rubella] gi|482560864|gb|EOA25055.1| hypothetical protein CARUB_v10018363mg [Capsella rubella] Length = 64 Score = 65.1 bits (157), Expect = 2e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 545 LWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 450 LWKMHHWNEQRK R+FYDLL++GEI+VVAAEE Sbjct: 33 LWKMHHWNEQRKTRSFYDLLERGEISVVAAEE 64 >ref|XP_008797451.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Phoenix dactylifera] Length = 64 Score = 64.7 bits (156), Expect = 3e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -3 Query: 545 LWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 450 +WKMHHWNEQRK RAFYD+L+KG+I+VVAAEE Sbjct: 33 MWKMHHWNEQRKTRAFYDMLEKGQISVVAAEE 64 >ref|NP_182260.1| cytochrome c oxidase subunit Vc family protein [Arabidopsis thaliana] gi|48427900|sp|O22912.1|CX5C1_ARATH RecName: Full=Probable cytochrome c oxidase subunit 5C-1; AltName: Full=Cytochrome c oxidase polypeptide Vc-1 gi|2275216|gb|AAB63838.1| putative cytochrome c oxidase Vc subunit [Arabidopsis thaliana] gi|17979511|gb|AAL50091.1| At2g47380/T8I13.22 [Arabidopsis thaliana] gi|20147289|gb|AAM10358.1| At2g47380/T8I13.22 [Arabidopsis thaliana] gi|330255740|gb|AEC10834.1| cytochrome c oxidase subunit Vc family protein [Arabidopsis thaliana] Length = 64 Score = 64.7 bits (156), Expect = 3e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 545 LWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 450 LWKMHHWNEQRK R FYDLL++GEI+VVAAEE Sbjct: 33 LWKMHHWNEQRKTRTFYDLLERGEISVVAAEE 64 >ref|XP_002880298.1| cytochrome c oxidase subunit VC family protein [Arabidopsis lyrata subsp. lyrata] gi|297326137|gb|EFH56557.1| cytochrome c oxidase subunit VC family protein [Arabidopsis lyrata subsp. lyrata] Length = 64 Score = 64.7 bits (156), Expect = 3e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 545 LWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 450 LWKMHHWNEQRK R FYDLL++GEI+VVAAEE Sbjct: 33 LWKMHHWNEQRKTRTFYDLLERGEISVVAAEE 64 >ref|XP_002862722.1| cytochrome c oxidase subunit VC family protein [Arabidopsis lyrata subsp. lyrata] gi|297817580|ref|XP_002876673.1| cytochrome c oxidase subunit VC family protein [Arabidopsis lyrata subsp. lyrata] gi|297308410|gb|EFH38980.1| cytochrome c oxidase subunit VC family protein [Arabidopsis lyrata subsp. lyrata] gi|297322511|gb|EFH52932.1| cytochrome c oxidase subunit VC family protein [Arabidopsis lyrata subsp. lyrata] Length = 64 Score = 64.7 bits (156), Expect = 3e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 545 LWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 450 LWKMHHWNEQRK R FYDLL++GEI+VVAAEE Sbjct: 33 LWKMHHWNEQRKTRTFYDLLERGEISVVAAEE 64 >ref|XP_010931748.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Elaeis guineensis] Length = 106 Score = 63.9 bits (154), Expect = 5e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 545 LWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 450 +WKMHHWNEQRK RAFYD+L+KG I+VVAAEE Sbjct: 75 MWKMHHWNEQRKTRAFYDMLEKGHISVVAAEE 106 >ref|XP_012474986.1| PREDICTED: cytochrome c oxidase subunit 5C [Gossypium raimondii] gi|728811821|gb|KHG00470.1| Cytochrome c oxidase subunit 5C [Gossypium arboreum] gi|763757082|gb|KJB24413.1| hypothetical protein B456_004G144400 [Gossypium raimondii] Length = 63 Score = 63.9 bits (154), Expect = 5e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 545 LWKMHHWNEQRKVRAFYDLLDKGEITVVAAE 453 LWKMHHWNEQRKVRAFYD+L+KGEI+V+A E Sbjct: 33 LWKMHHWNEQRKVRAFYDMLEKGEISVIAEE 63