BLASTX nr result
ID: Forsythia22_contig00029602
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00029602 (201 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011087407.1| PREDICTED: uncharacterized protein At5g08430... 57 2e-09 >ref|XP_011087407.1| PREDICTED: uncharacterized protein At5g08430 [Sesamum indicum] gi|747044128|ref|XP_011087415.1| PREDICTED: uncharacterized protein At5g08430 [Sesamum indicum] Length = 527 Score = 57.4 bits (137), Expect(2) = 2e-09 Identities = 31/43 (72%), Positives = 33/43 (76%) Frame = -1 Query: 201 EYLERRKQLQTPAVQEKLLLKIPGVIAEELLDPEGVPAGEKQK 73 EYLERRK LQTP+ QEKLLL IP VIAEE LDPEG A +K Sbjct: 316 EYLERRKTLQTPSEQEKLLLNIPEVIAEE-LDPEGTAADASEK 357 Score = 31.2 bits (69), Expect(2) = 2e-09 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = -3 Query: 82 KAEGTSGLPK*IPRMSSNVSSKDASG 5 KAEG++ PK I R SS+VSS DASG Sbjct: 357 KAEGSARSPKSILRGSSDVSSTDASG 382