BLASTX nr result
ID: Forsythia22_contig00029520
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00029520 (371 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010933949.1| PREDICTED: CBL-interacting protein kinase 9-... 57 4e-06 >ref|XP_010933949.1| PREDICTED: CBL-interacting protein kinase 9-like isoform X2 [Elaeis guineensis] Length = 416 Score = 57.4 bits (137), Expect = 4e-06 Identities = 31/74 (41%), Positives = 43/74 (58%), Gaps = 19/74 (25%) Frame = -2 Query: 370 LVKHEKGFISEFPANGII*KIEENSSPLGFDVKKN*YK-------------------FYK 248 ++K E F S+ P N I+ KIEE + PLGF+V+K+ YK FYK Sbjct: 336 VIKRETHFASQCPPNEIMSKIEEAAKPLGFNVRKHNYKMKLKGDKSGRKGYLSVATEFYK 395 Query: 247 NLSTGLKDVVWKSD 206 + S+GLKD+VWKS+ Sbjct: 396 SFSSGLKDIVWKSE 409