BLASTX nr result
ID: Forsythia22_contig00029508
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00029508 (613 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099697.1| PREDICTED: cyclin-dependent kinase E-1 [Sesa... 81 3e-13 ref|XP_002273171.1| PREDICTED: cyclin-dependent kinase E-1 [Viti... 80 8e-13 ref|XP_008227574.1| PREDICTED: cyclin-dependent kinase E-1 [Prun... 78 4e-12 ref|XP_007212082.1| hypothetical protein PRUPE_ppa005051mg [Prun... 78 4e-12 ref|XP_010243488.1| PREDICTED: cyclin-dependent kinase E-1 isofo... 77 7e-12 ref|XP_010243486.1| PREDICTED: cyclin-dependent kinase E-1 isofo... 77 7e-12 ref|XP_012086675.1| PREDICTED: cyclin-dependent kinase E-1 [Jatr... 77 7e-12 ref|XP_010546293.1| PREDICTED: cyclin-dependent kinase E-1 [Tare... 77 8e-12 ref|XP_007040591.1| Cyclin-dependent kinase E,1 isoform 2 [Theob... 77 8e-12 ref|XP_007040590.1| Cyclin-dependent kinase E,1 isoform 1 [Theob... 77 8e-12 ref|XP_006394257.1| hypothetical protein EUTSA_v10004142mg [Eutr... 77 8e-12 ref|XP_009384737.1| PREDICTED: cyclin-dependent kinase E-1-like ... 76 1e-11 ref|XP_010314133.1| PREDICTED: cyclin-dependent kinase E-1 isofo... 76 1e-11 ref|XP_010025720.1| PREDICTED: cyclin-dependent kinase E-1 isofo... 76 1e-11 ref|XP_009797764.1| PREDICTED: cyclin-dependent kinase E-1 [Nico... 76 1e-11 ref|XP_009616646.1| PREDICTED: cyclin-dependent kinase E-1-like,... 76 1e-11 ref|XP_010025723.1| PREDICTED: cyclin-dependent kinase E-1 isofo... 76 1e-11 ref|XP_002518859.1| cdk8, putative [Ricinus communis] gi|2235418... 76 1e-11 ref|XP_006362710.1| PREDICTED: cyclin-dependent kinase E-1-like ... 76 1e-11 ref|XP_004252198.1| PREDICTED: cyclin-dependent kinase E-1 isofo... 76 1e-11 >ref|XP_011099697.1| PREDICTED: cyclin-dependent kinase E-1 [Sesamum indicum] Length = 471 Score = 81.3 bits (199), Expect = 3e-13 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -3 Query: 122 QLNQLDKIFKVLGHPTQEKWPTLVNFPHWQFDL*HIQGHK 3 QL+QLDKIFKVLGHPTQEKWPTLVN PHWQ D+ HIQGHK Sbjct: 247 QLDQLDKIFKVLGHPTQEKWPTLVNLPHWQSDVQHIQGHK 286 >ref|XP_002273171.1| PREDICTED: cyclin-dependent kinase E-1 [Vitis vinifera] gi|296082615|emb|CBI21620.3| unnamed protein product [Vitis vinifera] Length = 481 Score = 80.1 bits (196), Expect = 8e-13 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -3 Query: 122 QLNQLDKIFKVLGHPTQEKWPTLVNFPHWQFDL*HIQGHK 3 QL+QLDKIF+VLGHPTQEKWPTLVN PHWQ D+ HIQGHK Sbjct: 256 QLDQLDKIFRVLGHPTQEKWPTLVNLPHWQSDVQHIQGHK 295 >ref|XP_008227574.1| PREDICTED: cyclin-dependent kinase E-1 [Prunus mume] Length = 479 Score = 77.8 bits (190), Expect = 4e-12 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = -3 Query: 122 QLNQLDKIFKVLGHPTQEKWPTLVNFPHWQFDL*HIQGHK 3 QL+QLDKIFKVLGHPT EKWPTL N PHWQ DL HIQGHK Sbjct: 259 QLDQLDKIFKVLGHPTLEKWPTLANLPHWQQDLQHIQGHK 298 >ref|XP_007212082.1| hypothetical protein PRUPE_ppa005051mg [Prunus persica] gi|462407947|gb|EMJ13281.1| hypothetical protein PRUPE_ppa005051mg [Prunus persica] Length = 479 Score = 77.8 bits (190), Expect = 4e-12 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = -3 Query: 122 QLNQLDKIFKVLGHPTQEKWPTLVNFPHWQFDL*HIQGHK 3 QL+QLDKIFKVLGHPT EKWPTL N PHWQ DL HIQGHK Sbjct: 259 QLDQLDKIFKVLGHPTLEKWPTLANLPHWQQDLQHIQGHK 298 >ref|XP_010243488.1| PREDICTED: cyclin-dependent kinase E-1 isoform X2 [Nelumbo nucifera] Length = 499 Score = 77.0 bits (188), Expect = 7e-12 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = -3 Query: 122 QLNQLDKIFKVLGHPTQEKWPTLVNFPHWQFDL*HIQGHK 3 QL+QLDKIFKVLGHPTQEKWPTLVN PHWQ D HIQG K Sbjct: 273 QLDQLDKIFKVLGHPTQEKWPTLVNLPHWQSDQQHIQGRK 312 >ref|XP_010243486.1| PREDICTED: cyclin-dependent kinase E-1 isoform X1 [Nelumbo nucifera] Length = 500 Score = 77.0 bits (188), Expect = 7e-12 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = -3 Query: 122 QLNQLDKIFKVLGHPTQEKWPTLVNFPHWQFDL*HIQGHK 3 QL+QLDKIFKVLGHPTQEKWPTLVN PHWQ D HIQG K Sbjct: 273 QLDQLDKIFKVLGHPTQEKWPTLVNLPHWQSDQQHIQGRK 312 >ref|XP_012086675.1| PREDICTED: cyclin-dependent kinase E-1 [Jatropha curcas] gi|643711834|gb|KDP25262.1| hypothetical protein JCGZ_20418 [Jatropha curcas] Length = 478 Score = 77.0 bits (188), Expect = 7e-12 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 122 QLNQLDKIFKVLGHPTQEKWPTLVNFPHWQFDL*HIQGHK 3 Q++QLDKIFKVLGHPT EKWPTL N PHWQ DL HIQGHK Sbjct: 255 QIDQLDKIFKVLGHPTIEKWPTLANLPHWQSDLQHIQGHK 294 >ref|XP_010546293.1| PREDICTED: cyclin-dependent kinase E-1 [Tarenaya hassleriana] Length = 476 Score = 76.6 bits (187), Expect = 8e-12 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 122 QLNQLDKIFKVLGHPTQEKWPTLVNFPHWQFDL*HIQGHK 3 QL+QLDKIFK+LGHPT EKWPTL N PHWQ DL HIQGHK Sbjct: 256 QLDQLDKIFKILGHPTLEKWPTLGNLPHWQSDLQHIQGHK 295 >ref|XP_007040591.1| Cyclin-dependent kinase E,1 isoform 2 [Theobroma cacao] gi|508777836|gb|EOY25092.1| Cyclin-dependent kinase E,1 isoform 2 [Theobroma cacao] Length = 554 Score = 76.6 bits (187), Expect = 8e-12 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 122 QLNQLDKIFKVLGHPTQEKWPTLVNFPHWQFDL*HIQGHK 3 QL+QLDKIFK+LGHPT EKWPTL N PHWQ DL HIQGHK Sbjct: 258 QLDQLDKIFKILGHPTLEKWPTLGNLPHWQSDLQHIQGHK 297 >ref|XP_007040590.1| Cyclin-dependent kinase E,1 isoform 1 [Theobroma cacao] gi|508777835|gb|EOY25091.1| Cyclin-dependent kinase E,1 isoform 1 [Theobroma cacao] Length = 481 Score = 76.6 bits (187), Expect = 8e-12 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 122 QLNQLDKIFKVLGHPTQEKWPTLVNFPHWQFDL*HIQGHK 3 QL+QLDKIFK+LGHPT EKWPTL N PHWQ DL HIQGHK Sbjct: 258 QLDQLDKIFKILGHPTLEKWPTLGNLPHWQSDLQHIQGHK 297 >ref|XP_006394257.1| hypothetical protein EUTSA_v10004142mg [Eutrema salsugineum] gi|312282185|dbj|BAJ33958.1| unnamed protein product [Thellungiella halophila] gi|557090896|gb|ESQ31543.1| hypothetical protein EUTSA_v10004142mg [Eutrema salsugineum] Length = 472 Score = 76.6 bits (187), Expect = 8e-12 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -3 Query: 122 QLNQLDKIFKVLGHPTQEKWPTLVNFPHWQFDL*HIQGHK 3 Q++QLDKIFK+LGHPT EKWPTLVN PHWQ DL HIQ HK Sbjct: 249 QVDQLDKIFKILGHPTMEKWPTLVNLPHWQADLQHIQAHK 288 >ref|XP_009384737.1| PREDICTED: cyclin-dependent kinase E-1-like [Musa acuminata subsp. malaccensis] Length = 466 Score = 76.3 bits (186), Expect = 1e-11 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 122 QLNQLDKIFKVLGHPTQEKWPTLVNFPHWQFDL*HIQGHK 3 QL+QLDKIFKVLGHPT E+WPTLVN PHWQ D HIQGHK Sbjct: 243 QLDQLDKIFKVLGHPTPERWPTLVNLPHWQNDQQHIQGHK 282 >ref|XP_010314133.1| PREDICTED: cyclin-dependent kinase E-1 isoform X2 [Solanum lycopersicum] Length = 456 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 122 QLNQLDKIFKVLGHPTQEKWPTLVNFPHWQFDL*HIQGHK 3 QL+QLDKIFKVLGHPT EKWPTLVN PHWQ D+ IQGHK Sbjct: 243 QLDQLDKIFKVLGHPTPEKWPTLVNLPHWQSDVQRIQGHK 282 >ref|XP_010025720.1| PREDICTED: cyclin-dependent kinase E-1 isoform X1 [Eucalyptus grandis] gi|702451506|ref|XP_010025722.1| PREDICTED: cyclin-dependent kinase E-1 isoform X1 [Eucalyptus grandis] Length = 480 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 122 QLNQLDKIFKVLGHPTQEKWPTLVNFPHWQFDL*HIQGHK 3 QL+QLDKIFKVLGHPTQEKWP LVN PHWQ D+ HIQ HK Sbjct: 259 QLDQLDKIFKVLGHPTQEKWPMLVNLPHWQSDVQHIQRHK 298 >ref|XP_009797764.1| PREDICTED: cyclin-dependent kinase E-1 [Nicotiana sylvestris] gi|698504509|ref|XP_009797765.1| PREDICTED: cyclin-dependent kinase E-1 [Nicotiana sylvestris] Length = 472 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 122 QLNQLDKIFKVLGHPTQEKWPTLVNFPHWQFDL*HIQGHK 3 QL+QLDKIFKVLGHPT EKWPTLVN PHWQ D+ IQGHK Sbjct: 249 QLDQLDKIFKVLGHPTPEKWPTLVNLPHWQSDVQRIQGHK 288 >ref|XP_009616646.1| PREDICTED: cyclin-dependent kinase E-1-like, partial [Nicotiana tomentosiformis] Length = 279 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 122 QLNQLDKIFKVLGHPTQEKWPTLVNFPHWQFDL*HIQGHK 3 QL+QLDKIFKVLGHPT EKWPTLVN PHWQ D+ IQGHK Sbjct: 55 QLDQLDKIFKVLGHPTPEKWPTLVNLPHWQSDVQRIQGHK 94 >ref|XP_010025723.1| PREDICTED: cyclin-dependent kinase E-1 isoform X2 [Eucalyptus grandis] gi|702451516|ref|XP_010025724.1| PREDICTED: cyclin-dependent kinase E-1 isoform X2 [Eucalyptus grandis] gi|629096442|gb|KCW62437.1| hypothetical protein EUGRSUZ_H05079 [Eucalyptus grandis] Length = 479 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 122 QLNQLDKIFKVLGHPTQEKWPTLVNFPHWQFDL*HIQGHK 3 QL+QLDKIFKVLGHPTQEKWP LVN PHWQ D+ HIQ HK Sbjct: 259 QLDQLDKIFKVLGHPTQEKWPMLVNLPHWQSDVQHIQRHK 298 >ref|XP_002518859.1| cdk8, putative [Ricinus communis] gi|223541846|gb|EEF43392.1| cdk8, putative [Ricinus communis] Length = 477 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = -3 Query: 122 QLNQLDKIFKVLGHPTQEKWPTLVNFPHWQFDL*HIQGHK 3 QL+QLDKIFKVLGHPT EKWPTL N PHWQ DL HIQ HK Sbjct: 255 QLDQLDKIFKVLGHPTLEKWPTLANLPHWQSDLQHIQAHK 294 >ref|XP_006362710.1| PREDICTED: cyclin-dependent kinase E-1-like isoform X1 [Solanum tuberosum] gi|565394121|ref|XP_006362711.1| PREDICTED: cyclin-dependent kinase E-1-like isoform X2 [Solanum tuberosum] gi|565394123|ref|XP_006362712.1| PREDICTED: cyclin-dependent kinase E-1-like isoform X3 [Solanum tuberosum] gi|565394125|ref|XP_006362713.1| PREDICTED: cyclin-dependent kinase E-1-like isoform X4 [Solanum tuberosum] Length = 467 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 122 QLNQLDKIFKVLGHPTQEKWPTLVNFPHWQFDL*HIQGHK 3 QL+QLDKIFKVLGHPT EKWPTLVN PHWQ D+ IQGHK Sbjct: 243 QLDQLDKIFKVLGHPTPEKWPTLVNLPHWQSDVQRIQGHK 282 >ref|XP_004252198.1| PREDICTED: cyclin-dependent kinase E-1 isoform X1 [Solanum lycopersicum] gi|723749766|ref|XP_010314132.1| PREDICTED: cyclin-dependent kinase E-1 isoform X1 [Solanum lycopersicum] Length = 467 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 122 QLNQLDKIFKVLGHPTQEKWPTLVNFPHWQFDL*HIQGHK 3 QL+QLDKIFKVLGHPT EKWPTLVN PHWQ D+ IQGHK Sbjct: 243 QLDQLDKIFKVLGHPTPEKWPTLVNLPHWQSDVQRIQGHK 282