BLASTX nr result
ID: Forsythia22_contig00029498
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00029498 (665 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008356898.1| PREDICTED: protein NIM1-INTERACTING 3-like [... 57 9e-06 >ref|XP_008356898.1| PREDICTED: protein NIM1-INTERACTING 3-like [Malus domestica] Length = 100 Score = 57.0 bits (136), Expect = 9e-06 Identities = 25/54 (46%), Positives = 37/54 (68%) Frame = -1 Query: 503 FFALIKSTRDIRQSMMSGVDQLKKKDSVKAIEDKPPVVAWNPSFQPEDFMEDLQ 342 FFALI+STR++R+ + + K+K K ED +WNP+FQPEDF+ED++ Sbjct: 24 FFALIRSTREVRERLRGNSNVSKEKTDEKKKEDGKAAGSWNPTFQPEDFLEDVK 77