BLASTX nr result
ID: Forsythia22_contig00029304
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00029304 (215 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004300513.1| PREDICTED: G-type lectin S-receptor-like ser... 112 7e-23 ref|XP_010094737.1| Cysteine-rich receptor-like protein kinase 1... 112 1e-22 ref|XP_012831387.1| PREDICTED: G-type lectin S-receptor-like ser... 110 5e-22 ref|XP_002278538.1| PREDICTED: cysteine-rich receptor-like prote... 110 5e-22 ref|XP_011045846.1| PREDICTED: putative receptor-like protein ki... 109 6e-22 ref|XP_012486438.1| PREDICTED: cysteine-rich receptor-like prote... 107 4e-21 emb|CDP19698.1| unnamed protein product [Coffea canephora] 107 4e-21 gb|KCW83879.1| hypothetical protein EUGRSUZ_B00734 [Eucalyptus g... 107 4e-21 ref|XP_010032095.1| PREDICTED: putative receptor-like protein ki... 107 4e-21 gb|KDO57483.1| hypothetical protein CISIN_1g013745mg [Citrus sin... 106 5e-21 ref|XP_006485811.1| PREDICTED: cysteine-rich receptor-like prote... 106 5e-21 ref|XP_006442632.1| hypothetical protein CICLE_v10020197mg [Citr... 106 5e-21 ref|XP_007209197.1| hypothetical protein PRUPE_ppa006449mg [Prun... 106 5e-21 ref|XP_007036551.1| Cysteine-rich RLK 29 isoform 2 [Theobroma ca... 105 1e-20 ref|XP_007036550.1| Cysteine-rich RLK 29 isoform 1 [Theobroma ca... 105 1e-20 ref|XP_003620444.1| Cysteine-rich receptor-like protein kinase [... 105 1e-20 ref|XP_008240250.1| PREDICTED: cysteine-rich receptor-like prote... 105 2e-20 ref|XP_008240249.1| PREDICTED: cysteine-rich receptor-like prote... 105 2e-20 ref|XP_007154147.1| hypothetical protein PHAVU_003G094400g [Phas... 103 3e-20 ref|XP_012574750.1| PREDICTED: LOW QUALITY PROTEIN: putative rec... 103 4e-20 >ref|XP_004300513.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase B120 [Fragaria vesca subsp. vesca] Length = 384 Score = 112 bits (281), Expect = 7e-23 Identities = 56/70 (80%), Positives = 61/70 (87%) Frame = +1 Query: 4 LLDAEKADLLNYTWTLFEAGKSEELVRGSLNKYNLDEAAMCIQLGLLCCQASIADRPDMN 183 LL+ EKADLL+YTW L+EAGK+ ELV SL KYN DEAAMCIQLGLLCCQAS A+RPDMN Sbjct: 249 LLEREKADLLSYTWMLYEAGKAMELVDPSLAKYNHDEAAMCIQLGLLCCQASHANRPDMN 308 Query: 184 SVHLMLSSDS 213 SVHLM SSDS Sbjct: 309 SVHLMFSSDS 318 >ref|XP_010094737.1| Cysteine-rich receptor-like protein kinase 10 [Morus notabilis] gi|587867505|gb|EXB56902.1| Cysteine-rich receptor-like protein kinase 10 [Morus notabilis] Length = 398 Score = 112 bits (280), Expect = 1e-22 Identities = 55/69 (79%), Positives = 60/69 (86%) Frame = +1 Query: 7 LDAEKADLLNYTWTLFEAGKSEELVRGSLNKYNLDEAAMCIQLGLLCCQASIADRPDMNS 186 L EKADLL+YTWTL++AGKS EL+ SL K N DEAAMCIQLGLLCCQA+ ADRPDMNS Sbjct: 178 LSGEKADLLSYTWTLYQAGKSLELLDPSLTKCNRDEAAMCIQLGLLCCQANTADRPDMNS 237 Query: 187 VHLMLSSDS 213 VHLMLSSDS Sbjct: 238 VHLMLSSDS 246 >ref|XP_012831387.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase B120 [Erythranthe guttatus] gi|604343430|gb|EYU42350.1| hypothetical protein MIMGU_mgv1a008080mg [Erythranthe guttata] Length = 385 Score = 110 bits (274), Expect = 5e-22 Identities = 50/69 (72%), Positives = 60/69 (86%) Frame = +1 Query: 7 LDAEKADLLNYTWTLFEAGKSEELVRGSLNKYNLDEAAMCIQLGLLCCQASIADRPDMNS 186 L +EKADLLNY W LF+AGKSEELV SL KYN +EA +C+QLGLLCCQAS++ RPDMN+ Sbjct: 252 LGSEKADLLNYAWNLFQAGKSEELVDESLEKYNSEEAILCVQLGLLCCQASVSSRPDMNT 311 Query: 187 VHLMLSSDS 213 VH+M+SSDS Sbjct: 312 VHVMVSSDS 320 >ref|XP_002278538.1| PREDICTED: cysteine-rich receptor-like protein kinase 8 [Vitis vinifera] gi|297734222|emb|CBI15469.3| unnamed protein product [Vitis vinifera] Length = 389 Score = 110 bits (274), Expect = 5e-22 Identities = 54/69 (78%), Positives = 59/69 (85%) Frame = +1 Query: 7 LDAEKADLLNYTWTLFEAGKSEELVRGSLNKYNLDEAAMCIQLGLLCCQASIADRPDMNS 186 L AEK DLL+YTW L++ GK+ ELV SL K N DEAAMCIQLGLLCCQAS+ADRPDMNS Sbjct: 257 LSAEKTDLLSYTWKLYQGGKALELVDPSLAKCNPDEAAMCIQLGLLCCQASVADRPDMNS 316 Query: 187 VHLMLSSDS 213 VHLMLSSDS Sbjct: 317 VHLMLSSDS 325 >ref|XP_011045846.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Populus euphratica] Length = 398 Score = 109 bits (273), Expect = 6e-22 Identities = 54/69 (78%), Positives = 59/69 (85%) Frame = +1 Query: 7 LDAEKADLLNYTWTLFEAGKSEELVRGSLNKYNLDEAAMCIQLGLLCCQASIADRPDMNS 186 L AEKADLLNYTW L++ GK+ ELV SL + N DEAAMCIQLGLLCCQ +IADRPDMNS Sbjct: 261 LGAEKADLLNYTWMLYQGGKTLELVDPSLARCNQDEAAMCIQLGLLCCQQNIADRPDMNS 320 Query: 187 VHLMLSSDS 213 VHLMLSSDS Sbjct: 321 VHLMLSSDS 329 >ref|XP_012486438.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Gossypium raimondii] gi|763769988|gb|KJB37203.1| hypothetical protein B456_006G194300 [Gossypium raimondii] gi|763769989|gb|KJB37204.1| hypothetical protein B456_006G194300 [Gossypium raimondii] gi|763769990|gb|KJB37205.1| hypothetical protein B456_006G194300 [Gossypium raimondii] Length = 323 Score = 107 bits (266), Expect = 4e-21 Identities = 50/69 (72%), Positives = 59/69 (85%) Frame = +1 Query: 7 LDAEKADLLNYTWTLFEAGKSEELVRGSLNKYNLDEAAMCIQLGLLCCQASIADRPDMNS 186 L +EKADLLNY+W LF++GK +LV +L KYN DEAAMCIQLGLLCCQ ++ +RPDMNS Sbjct: 188 LGSEKADLLNYSWLLFQSGKMLDLVDPTLKKYNPDEAAMCIQLGLLCCQQTVVERPDMNS 247 Query: 187 VHLMLSSDS 213 VHLMLSSDS Sbjct: 248 VHLMLSSDS 256 >emb|CDP19698.1| unnamed protein product [Coffea canephora] Length = 400 Score = 107 bits (266), Expect = 4e-21 Identities = 53/71 (74%), Positives = 58/71 (81%) Frame = +1 Query: 1 GLLDAEKADLLNYTWTLFEAGKSEELVRGSLNKYNLDEAAMCIQLGLLCCQASIADRPDM 180 G L AEKADLLNY WTL++A + ELV LNKYN EAAMCIQLGLLCCQAS+A+R DM Sbjct: 254 GRLGAEKADLLNYAWTLYQAENALELVDAGLNKYNAVEAAMCIQLGLLCCQASVAERLDM 313 Query: 181 NSVHLMLSSDS 213 NSVHL LSSDS Sbjct: 314 NSVHLTLSSDS 324 >gb|KCW83879.1| hypothetical protein EUGRSUZ_B00734 [Eucalyptus grandis] Length = 321 Score = 107 bits (266), Expect = 4e-21 Identities = 54/71 (76%), Positives = 57/71 (80%) Frame = +1 Query: 1 GLLDAEKADLLNYTWTLFEAGKSEELVRGSLNKYNLDEAAMCIQLGLLCCQASIADRPDM 180 G L AEK DLL+Y W LF+ GKS +LV SL KYN DEAAM IQLGLLCCQAS DRPDM Sbjct: 186 GRLGAEKTDLLSYAWKLFQEGKSLDLVDSSLVKYNPDEAAMSIQLGLLCCQASYGDRPDM 245 Query: 181 NSVHLMLSSDS 213 NSVHLMLSSDS Sbjct: 246 NSVHLMLSSDS 256 >ref|XP_010032095.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Eucalyptus grandis] gi|629119388|gb|KCW83878.1| hypothetical protein EUGRSUZ_B00734 [Eucalyptus grandis] Length = 406 Score = 107 bits (266), Expect = 4e-21 Identities = 54/71 (76%), Positives = 57/71 (80%) Frame = +1 Query: 1 GLLDAEKADLLNYTWTLFEAGKSEELVRGSLNKYNLDEAAMCIQLGLLCCQASIADRPDM 180 G L AEK DLL+Y W LF+ GKS +LV SL KYN DEAAM IQLGLLCCQAS DRPDM Sbjct: 271 GRLGAEKTDLLSYAWKLFQEGKSLDLVDSSLVKYNPDEAAMSIQLGLLCCQASYGDRPDM 330 Query: 181 NSVHLMLSSDS 213 NSVHLMLSSDS Sbjct: 331 NSVHLMLSSDS 341 >gb|KDO57483.1| hypothetical protein CISIN_1g013745mg [Citrus sinensis] Length = 437 Score = 106 bits (265), Expect = 5e-21 Identities = 53/71 (74%), Positives = 58/71 (81%) Frame = +1 Query: 1 GLLDAEKADLLNYTWTLFEAGKSEELVRGSLNKYNLDEAAMCIQLGLLCCQASIADRPDM 180 G L EKADLL+YTWTLF+ K+ ELV SL K N DEAAMCIQLGLLCCQ S+A+RPDM Sbjct: 292 GRLGKEKADLLSYTWTLFQGEKALELVDPSLAKCNRDEAAMCIQLGLLCCQQSVAERPDM 351 Query: 181 NSVHLMLSSDS 213 NSVHLMLS DS Sbjct: 352 NSVHLMLSGDS 362 >ref|XP_006485811.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like [Citrus sinensis] Length = 437 Score = 106 bits (265), Expect = 5e-21 Identities = 53/71 (74%), Positives = 58/71 (81%) Frame = +1 Query: 1 GLLDAEKADLLNYTWTLFEAGKSEELVRGSLNKYNLDEAAMCIQLGLLCCQASIADRPDM 180 G L EKADLL+YTWTLF+ K+ ELV SL K N DEAAMCIQLGLLCCQ S+A+RPDM Sbjct: 292 GRLGKEKADLLSYTWTLFQGEKALELVDPSLAKCNRDEAAMCIQLGLLCCQQSVAERPDM 351 Query: 181 NSVHLMLSSDS 213 NSVHLMLS DS Sbjct: 352 NSVHLMLSGDS 362 >ref|XP_006442632.1| hypothetical protein CICLE_v10020197mg [Citrus clementina] gi|557544894|gb|ESR55872.1| hypothetical protein CICLE_v10020197mg [Citrus clementina] Length = 436 Score = 106 bits (265), Expect = 5e-21 Identities = 53/71 (74%), Positives = 58/71 (81%) Frame = +1 Query: 1 GLLDAEKADLLNYTWTLFEAGKSEELVRGSLNKYNLDEAAMCIQLGLLCCQASIADRPDM 180 G L EKADLL+YTWTLF+ K+ ELV SL K N DEAAMCIQLGLLCCQ S+A+RPDM Sbjct: 290 GRLGKEKADLLSYTWTLFQGEKALELVDPSLAKCNRDEAAMCIQLGLLCCQQSVAERPDM 349 Query: 181 NSVHLMLSSDS 213 NSVHLMLS DS Sbjct: 350 NSVHLMLSGDS 360 >ref|XP_007209197.1| hypothetical protein PRUPE_ppa006449mg [Prunus persica] gi|462404932|gb|EMJ10396.1| hypothetical protein PRUPE_ppa006449mg [Prunus persica] Length = 411 Score = 106 bits (265), Expect = 5e-21 Identities = 50/71 (70%), Positives = 60/71 (84%) Frame = +1 Query: 1 GLLDAEKADLLNYTWTLFEAGKSEELVRGSLNKYNLDEAAMCIQLGLLCCQASIADRPDM 180 G L+ EKADLL+YTW L++ GK+ +LV +L + N DEAAMCIQLGLLCCQAS+ADRPDM Sbjct: 276 GRLEREKADLLSYTWKLYQGGKALDLVDPTLARCNPDEAAMCIQLGLLCCQASVADRPDM 335 Query: 181 NSVHLMLSSDS 213 NS+HLM SSDS Sbjct: 336 NSIHLMFSSDS 346 >ref|XP_007036551.1| Cysteine-rich RLK 29 isoform 2 [Theobroma cacao] gi|508773796|gb|EOY21052.1| Cysteine-rich RLK 29 isoform 2 [Theobroma cacao] Length = 321 Score = 105 bits (262), Expect = 1e-20 Identities = 49/69 (71%), Positives = 59/69 (85%) Frame = +1 Query: 7 LDAEKADLLNYTWTLFEAGKSEELVRGSLNKYNLDEAAMCIQLGLLCCQASIADRPDMNS 186 L EKADLL+Y W LF+ G+S +LV +L+KYN DEAAMCIQLGLLCCQ ++++RPDMNS Sbjct: 188 LGTEKADLLSYAWILFQGGQSLDLVDPTLDKYNRDEAAMCIQLGLLCCQQTVSERPDMNS 247 Query: 187 VHLMLSSDS 213 VHLMLSSDS Sbjct: 248 VHLMLSSDS 256 >ref|XP_007036550.1| Cysteine-rich RLK 29 isoform 1 [Theobroma cacao] gi|508773795|gb|EOY21051.1| Cysteine-rich RLK 29 isoform 1 [Theobroma cacao] Length = 390 Score = 105 bits (262), Expect = 1e-20 Identities = 49/69 (71%), Positives = 59/69 (85%) Frame = +1 Query: 7 LDAEKADLLNYTWTLFEAGKSEELVRGSLNKYNLDEAAMCIQLGLLCCQASIADRPDMNS 186 L EKADLL+Y W LF+ G+S +LV +L+KYN DEAAMCIQLGLLCCQ ++++RPDMNS Sbjct: 257 LGTEKADLLSYAWILFQGGQSLDLVDPTLDKYNRDEAAMCIQLGLLCCQQTVSERPDMNS 316 Query: 187 VHLMLSSDS 213 VHLMLSSDS Sbjct: 317 VHLMLSSDS 325 >ref|XP_003620444.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] gi|355495459|gb|AES76662.1| Serine/Threonine kinase family protein [Medicago truncatula] Length = 384 Score = 105 bits (262), Expect = 1e-20 Identities = 49/69 (71%), Positives = 59/69 (85%) Frame = +1 Query: 7 LDAEKADLLNYTWTLFEAGKSEELVRGSLNKYNLDEAAMCIQLGLLCCQASIADRPDMNS 186 LDAEKADLL+Y W L++ GK +L+ ++ KYN DEAAMCIQLGLLCCQAS+ +RPDMNS Sbjct: 255 LDAEKADLLSYAWKLYQGGKIMDLIDQNIGKYNGDEAAMCIQLGLLCCQASLVERPDMNS 314 Query: 187 VHLMLSSDS 213 V+LMLSSDS Sbjct: 315 VNLMLSSDS 323 >ref|XP_008240250.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform X2 [Prunus mume] Length = 326 Score = 105 bits (261), Expect = 2e-20 Identities = 48/71 (67%), Positives = 60/71 (84%) Frame = +1 Query: 1 GLLDAEKADLLNYTWTLFEAGKSEELVRGSLNKYNLDEAAMCIQLGLLCCQASIADRPDM 180 G L+ EKADLL+YTW L++ GK+ +LV +L + N DEAAMC+QLGLLCCQA++ADRPDM Sbjct: 191 GQLEREKADLLSYTWKLYQGGKALDLVDPTLARCNPDEAAMCVQLGLLCCQATVADRPDM 250 Query: 181 NSVHLMLSSDS 213 NS+HLM SSDS Sbjct: 251 NSIHLMFSSDS 261 >ref|XP_008240249.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform X1 [Prunus mume] Length = 390 Score = 105 bits (261), Expect = 2e-20 Identities = 48/71 (67%), Positives = 60/71 (84%) Frame = +1 Query: 1 GLLDAEKADLLNYTWTLFEAGKSEELVRGSLNKYNLDEAAMCIQLGLLCCQASIADRPDM 180 G L+ EKADLL+YTW L++ GK+ +LV +L + N DEAAMC+QLGLLCCQA++ADRPDM Sbjct: 255 GQLEREKADLLSYTWKLYQGGKALDLVDPTLARCNPDEAAMCVQLGLLCCQATVADRPDM 314 Query: 181 NSVHLMLSSDS 213 NS+HLM SSDS Sbjct: 315 NSIHLMFSSDS 325 >ref|XP_007154147.1| hypothetical protein PHAVU_003G094400g [Phaseolus vulgaris] gi|561027501|gb|ESW26141.1| hypothetical protein PHAVU_003G094400g [Phaseolus vulgaris] Length = 387 Score = 103 bits (258), Expect = 3e-20 Identities = 48/69 (69%), Positives = 58/69 (84%) Frame = +1 Query: 7 LDAEKADLLNYTWTLFEAGKSEELVRGSLNKYNLDEAAMCIQLGLLCCQASIADRPDMNS 186 L EKADLL+Y W+L++ G+ EL+ +L KYN DEAAMCIQLGLLCCQ+SI +RPDMN+ Sbjct: 257 LGPEKADLLSYAWSLYQGGRIMELIDSTLGKYNGDEAAMCIQLGLLCCQSSIIERPDMNA 316 Query: 187 VHLMLSSDS 213 VHLMLSSDS Sbjct: 317 VHLMLSSDS 325 >ref|XP_012574750.1| PREDICTED: LOW QUALITY PROTEIN: putative receptor-like protein kinase At4g00960 [Cicer arietinum] Length = 384 Score = 103 bits (257), Expect = 4e-20 Identities = 47/69 (68%), Positives = 56/69 (81%) Frame = +1 Query: 7 LDAEKADLLNYTWTLFEAGKSEELVRGSLNKYNLDEAAMCIQLGLLCCQASIADRPDMNS 186 L AEK D+L+Y W L++ GK +L+ + KYN DEAAMCIQLGLLCCQAS+ +RPDMNS Sbjct: 255 LGAEKVDILSYAWMLYQGGKIMDLIDEKVGKYNSDEAAMCIQLGLLCCQASVVERPDMNS 314 Query: 187 VHLMLSSDS 213 VHLMLSSDS Sbjct: 315 VHLMLSSDS 323