BLASTX nr result
ID: Forsythia22_contig00029115
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00029115 (432 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010112635.1| hypothetical protein L484_019087 [Morus nota... 69 2e-09 ref|XP_011089161.1| PREDICTED: mitochondrial dicarboxylate/trica... 69 2e-09 ref|XP_011089721.1| PREDICTED: mitochondrial dicarboxylate/trica... 67 6e-09 ref|XP_010693816.1| PREDICTED: mitochondrial dicarboxylate/trica... 66 8e-09 emb|CBI29951.3| unnamed protein product [Vitis vinifera] 66 8e-09 gb|EYU31675.1| hypothetical protein MIMGU_mgv1a010886mg [Erythra... 66 8e-09 gb|EYU31674.1| hypothetical protein MIMGU_mgv1a010886mg [Erythra... 66 8e-09 ref|XP_012844237.1| PREDICTED: mitochondrial dicarboxylate/trica... 66 8e-09 ref|XP_012844236.1| PREDICTED: mitochondrial dicarboxylate/trica... 66 8e-09 ref|XP_002281600.1| PREDICTED: mitochondrial dicarboxylate/trica... 66 8e-09 emb|CAC84546.1| dicarboxylate/tricarboxylate carrier [Nicotiana ... 66 1e-08 ref|XP_009796571.1| PREDICTED: mitochondrial dicarboxylate/trica... 66 1e-08 ref|XP_009620891.1| PREDICTED: mitochondrial dicarboxylate/trica... 66 1e-08 emb|CAC12820.1| mitochondrial 2-oxoglutarate/malate carrier prot... 66 1e-08 emb|CAC84545.1| dicarboxylate/tricarboxylate carrier [Nicotiana ... 66 1e-08 gb|KHG08670.1| mitochondrial 2-oxoglutarate/malate carrier [Goss... 65 2e-08 emb|CDP17587.1| unnamed protein product, partial [Coffea canephora] 65 2e-08 ref|XP_006445596.1| hypothetical protein CICLE_v10016099mg [Citr... 65 2e-08 gb|AAR06239.1| dicarboxylate/tricarboxylate carrier [Citrus junos] 65 2e-08 ref|XP_012471768.1| PREDICTED: mitochondrial dicarboxylate/trica... 65 2e-08 >ref|XP_010112635.1| hypothetical protein L484_019087 [Morus notabilis] gi|587948227|gb|EXC34490.1| hypothetical protein L484_019087 [Morus notabilis] Length = 299 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -3 Query: 430 KSTGMWPAVKPFVNGGASGMLAICVIQPIDMIKV 329 KSTG+WP VKPFVNGGASGMLA CVIQPIDMIKV Sbjct: 8 KSTGVWPTVKPFVNGGASGMLATCVIQPIDMIKV 41 >ref|XP_011089161.1| PREDICTED: mitochondrial dicarboxylate/tricarboxylate transporter DTC-like [Sesamum indicum] Length = 298 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -3 Query: 430 KSTGMWPAVKPFVNGGASGMLAICVIQPIDMIKV 329 KSTG+WP VKPFVNGGASGMLA CVIQPIDMIKV Sbjct: 7 KSTGVWPTVKPFVNGGASGMLATCVIQPIDMIKV 40 >ref|XP_011089721.1| PREDICTED: mitochondrial dicarboxylate/tricarboxylate transporter DTC [Sesamum indicum] Length = 298 Score = 66.6 bits (161), Expect = 6e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 430 KSTGMWPAVKPFVNGGASGMLAICVIQPIDMIKV 329 KS G+WP VKPFVNGGASGMLA CVIQPIDMIKV Sbjct: 7 KSAGVWPTVKPFVNGGASGMLATCVIQPIDMIKV 40 >ref|XP_010693816.1| PREDICTED: mitochondrial dicarboxylate/tricarboxylate transporter DTC-like [Beta vulgaris subsp. vulgaris] gi|870846172|gb|KMS98767.1| hypothetical protein BVRB_3g068440 [Beta vulgaris subsp. vulgaris] Length = 299 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -3 Query: 430 KSTGMWPAVKPFVNGGASGMLAICVIQPIDMIKV 329 K TG+WP +KPFVNGGASGMLA CVIQPIDMIKV Sbjct: 8 KPTGVWPTIKPFVNGGASGMLATCVIQPIDMIKV 41 >emb|CBI29951.3| unnamed protein product [Vitis vinifera] Length = 295 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 430 KSTGMWPAVKPFVNGGASGMLAICVIQPIDMIKV 329 KS G+WP+VKPFVNGGASGMLA CVIQP+DMIKV Sbjct: 7 KSKGVWPSVKPFVNGGASGMLATCVIQPVDMIKV 40 >gb|EYU31675.1| hypothetical protein MIMGU_mgv1a010886mg [Erythranthe guttata] Length = 271 Score = 66.2 bits (160), Expect = 8e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 430 KSTGMWPAVKPFVNGGASGMLAICVIQPIDMIKV 329 KS G+WP VKPFVNGGASGMLA CVIQPIDMIKV Sbjct: 7 KSLGVWPTVKPFVNGGASGMLATCVIQPIDMIKV 40 >gb|EYU31674.1| hypothetical protein MIMGU_mgv1a010886mg [Erythranthe guttata] Length = 290 Score = 66.2 bits (160), Expect = 8e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 430 KSTGMWPAVKPFVNGGASGMLAICVIQPIDMIKV 329 KS G+WP VKPFVNGGASGMLA CVIQPIDMIKV Sbjct: 7 KSLGVWPTVKPFVNGGASGMLATCVIQPIDMIKV 40 >ref|XP_012844237.1| PREDICTED: mitochondrial dicarboxylate/tricarboxylate transporter DTC isoform X2 [Erythranthe guttatus] gi|604320936|gb|EYU31673.1| hypothetical protein MIMGU_mgv1a010886mg [Erythranthe guttata] Length = 296 Score = 66.2 bits (160), Expect = 8e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 430 KSTGMWPAVKPFVNGGASGMLAICVIQPIDMIKV 329 KS G+WP VKPFVNGGASGMLA CVIQPIDMIKV Sbjct: 7 KSLGVWPTVKPFVNGGASGMLATCVIQPIDMIKV 40 >ref|XP_012844236.1| PREDICTED: mitochondrial dicarboxylate/tricarboxylate transporter DTC isoform X1 [Erythranthe guttatus] gi|604320935|gb|EYU31672.1| hypothetical protein MIMGU_mgv1a010886mg [Erythranthe guttata] Length = 298 Score = 66.2 bits (160), Expect = 8e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 430 KSTGMWPAVKPFVNGGASGMLAICVIQPIDMIKV 329 KS G+WP VKPFVNGGASGMLA CVIQPIDMIKV Sbjct: 7 KSLGVWPTVKPFVNGGASGMLATCVIQPIDMIKV 40 >ref|XP_002281600.1| PREDICTED: mitochondrial dicarboxylate/tricarboxylate transporter DTC [Vitis vinifera] Length = 298 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 430 KSTGMWPAVKPFVNGGASGMLAICVIQPIDMIKV 329 KS G+WP+VKPFVNGGASGMLA CVIQP+DMIKV Sbjct: 7 KSKGVWPSVKPFVNGGASGMLATCVIQPVDMIKV 40 >emb|CAC84546.1| dicarboxylate/tricarboxylate carrier [Nicotiana tabacum] Length = 295 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 430 KSTGMWPAVKPFVNGGASGMLAICVIQPIDMIKV 329 KS G+WP VKPFVNGGASGMLA CVIQPIDMIKV Sbjct: 4 KSGGVWPTVKPFVNGGASGMLATCVIQPIDMIKV 37 >ref|XP_009796571.1| PREDICTED: mitochondrial dicarboxylate/tricarboxylate transporter DTC-like [Nicotiana sylvestris] Length = 297 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 430 KSTGMWPAVKPFVNGGASGMLAICVIQPIDMIKV 329 KS G+WP VKPFVNGGASGMLA CVIQPIDMIKV Sbjct: 6 KSGGVWPTVKPFVNGGASGMLATCVIQPIDMIKV 39 >ref|XP_009620891.1| PREDICTED: mitochondrial dicarboxylate/tricarboxylate transporter DTC-like [Nicotiana tomentosiformis] Length = 297 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 430 KSTGMWPAVKPFVNGGASGMLAICVIQPIDMIKV 329 KS G+WP VKPFVNGGASGMLA CVIQPIDMIKV Sbjct: 6 KSGGVWPTVKPFVNGGASGMLATCVIQPIDMIKV 39 >emb|CAC12820.1| mitochondrial 2-oxoglutarate/malate carrier protein [Nicotiana tabacum] Length = 297 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 430 KSTGMWPAVKPFVNGGASGMLAICVIQPIDMIKV 329 KS G+WP VKPFVNGGASGMLA CVIQPIDMIKV Sbjct: 6 KSGGVWPTVKPFVNGGASGMLATCVIQPIDMIKV 39 >emb|CAC84545.1| dicarboxylate/tricarboxylate carrier [Nicotiana tabacum] Length = 297 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 430 KSTGMWPAVKPFVNGGASGMLAICVIQPIDMIKV 329 KS G+WP VKPFVNGGASGMLA CVIQPIDMIKV Sbjct: 6 KSGGVWPTVKPFVNGGASGMLATCVIQPIDMIKV 39 >gb|KHG08670.1| mitochondrial 2-oxoglutarate/malate carrier [Gossypium arboreum] Length = 312 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -3 Query: 430 KSTGMWPAVKPFVNGGASGMLAICVIQPIDMIKV 329 +S G+WP VKPFVNGGASGMLA CVIQPIDMIKV Sbjct: 8 QSAGVWPTVKPFVNGGASGMLATCVIQPIDMIKV 41 >emb|CDP17587.1| unnamed protein product, partial [Coffea canephora] Length = 123 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 424 TGMWPAVKPFVNGGASGMLAICVIQPIDMIKV 329 TG+WP VKPFVNGGASGMLA CVIQPIDMIKV Sbjct: 12 TGVWPTVKPFVNGGASGMLATCVIQPIDMIKV 43 >ref|XP_006445596.1| hypothetical protein CICLE_v10016099mg [Citrus clementina] gi|568871521|ref|XP_006488932.1| PREDICTED: mitochondrial dicarboxylate/tricarboxylate transporter DTC-like [Citrus sinensis] gi|557548207|gb|ESR58836.1| hypothetical protein CICLE_v10016099mg [Citrus clementina] gi|641835472|gb|KDO54447.1| hypothetical protein CISIN_1g022322mg [Citrus sinensis] Length = 299 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -3 Query: 430 KSTGMWPAVKPFVNGGASGMLAICVIQPIDMIKV 329 +S G+WP VKPFVNGGASGMLA CVIQPIDMIKV Sbjct: 8 QSAGVWPTVKPFVNGGASGMLATCVIQPIDMIKV 41 >gb|AAR06239.1| dicarboxylate/tricarboxylate carrier [Citrus junos] Length = 299 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -3 Query: 430 KSTGMWPAVKPFVNGGASGMLAICVIQPIDMIKV 329 +S G+WP VKPFVNGGASGMLA CVIQPIDMIKV Sbjct: 8 QSAGVWPTVKPFVNGGASGMLATCVIQPIDMIKV 41 >ref|XP_012471768.1| PREDICTED: mitochondrial dicarboxylate/tricarboxylate transporter DTC [Gossypium raimondii] gi|763753188|gb|KJB20576.1| hypothetical protein B456_003G154700 [Gossypium raimondii] gi|763753190|gb|KJB20578.1| hypothetical protein B456_003G154700 [Gossypium raimondii] Length = 299 Score = 64.7 bits (156), Expect = 2e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 430 KSTGMWPAVKPFVNGGASGMLAICVIQPIDMIKV 329 +S G+WP VKPFVNGGASGMLA CVIQPIDM+KV Sbjct: 8 QSAGVWPTVKPFVNGGASGMLATCVIQPIDMVKV 41