BLASTX nr result
ID: Forsythia22_contig00028965
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00028965 (263 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ67129.1| hypothetical protein M437DRAFT_79786 [Aureobasidi... 124 2e-26 gb|KEQ93516.1| hypothetical protein AUEXF2481DRAFT_41754 [Aureob... 123 4e-26 ref|XP_007673417.1| hypothetical protein BAUCODRAFT_119538 [Baud... 122 9e-26 gb|KIW56245.1| 60S ribosomal protein L29 [Exophiala xenobiotica] 121 2e-25 gb|KIW00840.1| 60S ribosomal protein L29 [Verruconis gallopava] 121 2e-25 ref|XP_007724251.1| large subunit ribosomal protein L29e [Capron... 121 2e-25 ref|XP_007931347.1| hypothetical protein MYCFIDRAFT_65593 [Pseud... 121 2e-25 ref|XP_003841913.1| hypothetical protein LEMA_P098430.1 [Leptosp... 102 3e-25 gb|KEQ77333.1| hypothetical protein M436DRAFT_77222 [Aureobasidi... 120 3e-25 ref|XP_008022597.1| hypothetical protein SETTUDRAFT_167470 [Seto... 120 5e-25 ref|XP_007685045.1| hypothetical protein COCMIDRAFT_87475, parti... 120 5e-25 gb|EME39946.1| hypothetical protein DOTSEDRAFT_47443 [Dothistrom... 119 1e-24 ref|XP_003303931.1| 60S ribosomal protein L29 [Pyrenophora teres... 119 1e-24 ref|XP_002846081.1| 60S ribosomal protein L29 [Arthroderma otae ... 119 1e-24 ref|XP_001936717.1| conserved hypothetical protein [Pyrenophora ... 119 1e-24 gb|KIW48209.1| 60S ribosomal protein L29 [Exophiala oligosperma] 118 1e-24 ref|XP_001245359.1| 60S ribosomal protein L29 [Coccidioides immi... 118 2e-24 ref|XP_007732328.1| large subunit ribosomal protein L29e [Capron... 117 2e-24 ref|XP_007784263.1| 60S ribosomal protein L29 [Coniosporium apol... 117 2e-24 ref|XP_001805871.1| hypothetical protein SNOG_15733 [Phaeosphaer... 117 2e-24 >gb|KEQ67129.1| hypothetical protein M437DRAFT_79786 [Aureobasidium melanogenum CBS 110374] gi|662522734|gb|KEQ80132.1| hypothetical protein M438DRAFT_339199 [Aureobasidium pullulans EXF-150] Length = 65 Score = 124 bits (312), Expect = 2e-26 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = -3 Query: 261 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA 88 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA Sbjct: 8 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA 65 >gb|KEQ93516.1| hypothetical protein AUEXF2481DRAFT_41754 [Aureobasidium subglaciale EXF-2481] Length = 65 Score = 123 bits (309), Expect = 4e-26 Identities = 57/58 (98%), Positives = 58/58 (100%) Frame = -3 Query: 261 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA 88 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVK+GKRESA Sbjct: 8 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKDGKRESA 65 >ref|XP_007673417.1| hypothetical protein BAUCODRAFT_119538 [Baudoinia compniacensis UAMH 10762] gi|449303971|gb|EMC99978.1| hypothetical protein BAUCODRAFT_119538 [Baudoinia compniacensis UAMH 10762] Length = 65 Score = 122 bits (306), Expect = 9e-26 Identities = 56/58 (96%), Positives = 58/58 (100%) Frame = -3 Query: 261 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA 88 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKR++A Sbjct: 8 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRDAA 65 >gb|KIW56245.1| 60S ribosomal protein L29 [Exophiala xenobiotica] Length = 75 Score = 121 bits (303), Expect = 2e-25 Identities = 55/58 (94%), Positives = 58/58 (100%) Frame = -3 Query: 261 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA 88 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTM+ALKEVKEGKR++A Sbjct: 18 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDTA 75 >gb|KIW00840.1| 60S ribosomal protein L29 [Verruconis gallopava] Length = 65 Score = 121 bits (303), Expect = 2e-25 Identities = 55/58 (94%), Positives = 58/58 (100%) Frame = -3 Query: 261 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA 88 SQHNQ+KKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKR++A Sbjct: 8 SQHNQSKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRDAA 65 >ref|XP_007724251.1| large subunit ribosomal protein L29e [Capronia coronata CBS 617.96] gi|590013042|gb|EXJ88245.1| large subunit ribosomal protein L29e [Capronia coronata CBS 617.96] Length = 121 Score = 121 bits (303), Expect = 2e-25 Identities = 55/58 (94%), Positives = 58/58 (100%) Frame = -3 Query: 261 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA 88 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTM+ALKEVKEGKR++A Sbjct: 64 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 121 >ref|XP_007931347.1| hypothetical protein MYCFIDRAFT_65593 [Pseudocercospora fijiensis CIRAD86] gi|452977967|gb|EME77731.1| hypothetical protein MYCFIDRAFT_65593 [Pseudocercospora fijiensis CIRAD86] Length = 65 Score = 121 bits (303), Expect = 2e-25 Identities = 55/58 (94%), Positives = 58/58 (100%) Frame = -3 Query: 261 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA 88 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTM+ALKEVKEGKR++A Sbjct: 8 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 65 >ref|XP_003841913.1| hypothetical protein LEMA_P098430.1 [Leptosphaeria maculans JN3] gi|312218488|emb|CBX98434.1| hypothetical protein LEMA_P098430.1 [Leptosphaeria maculans JN3] Length = 119 Score = 102 bits (253), Expect(3) = 3e-25 Identities = 45/55 (81%), Positives = 51/55 (92%) Frame = -3 Query: 261 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKR 97 SQHNQ+KK H+NGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRAL + +G++ Sbjct: 8 SQHNQSKKNHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALVQGGQGRQ 62 Score = 34.7 bits (78), Expect(3) = 3e-25 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 50 GFGSFMRHLVGVNGIR 3 GF SFMRHLVGVNGIR Sbjct: 77 GFDSFMRHLVGVNGIR 92 Score = 25.4 bits (54), Expect(3) = 3e-25 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -2 Query: 121 EGGQGGQARVGIKDDTITSER 59 +GGQG QAR GI + T T+ER Sbjct: 56 QGGQGRQARCGI-NTTTTNER 75 >gb|KEQ77333.1| hypothetical protein M436DRAFT_77222 [Aureobasidium namibiae CBS 147.97] Length = 65 Score = 120 bits (302), Expect = 3e-25 Identities = 56/58 (96%), Positives = 58/58 (100%) Frame = -3 Query: 261 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA 88 SQHNQAKKAHKNGIKKPKT+RYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRE+A Sbjct: 8 SQHNQAKKAHKNGIKKPKTNRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKREAA 65 >ref|XP_008022597.1| hypothetical protein SETTUDRAFT_167470 [Setosphaeria turcica Et28A] gi|482812914|gb|EOA89618.1| hypothetical protein SETTUDRAFT_167470 [Setosphaeria turcica Et28A] Length = 65 Score = 120 bits (300), Expect = 5e-25 Identities = 55/58 (94%), Positives = 57/58 (98%) Frame = -3 Query: 261 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA 88 SQHNQ+KK H+NGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA Sbjct: 8 SQHNQSKKNHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA 65 >ref|XP_007685045.1| hypothetical protein COCMIDRAFT_87475, partial [Bipolaris oryzae ATCC 44560] gi|628060456|ref|XP_007696225.1| hypothetical protein COCSADRAFT_80195, partial [Bipolaris sorokiniana ND90Pr] gi|628181400|ref|XP_007706418.1| hypothetical protein COCCADRAFT_80670, partial [Bipolaris zeicola 26-R-13] gi|451855393|gb|EMD68685.1| hypothetical protein COCSADRAFT_80195, partial [Bipolaris sorokiniana ND90Pr] gi|452004436|gb|EMD96892.1| hypothetical protein COCHEDRAFT_1085190, partial [Bipolaris maydis C5] gi|477586677|gb|ENI03761.1| hypothetical protein COCC4DRAFT_142547, partial [Bipolaris maydis ATCC 48331] gi|576925237|gb|EUC39342.1| hypothetical protein COCCADRAFT_80670, partial [Bipolaris zeicola 26-R-13] gi|576934887|gb|EUC48396.1| hypothetical protein COCMIDRAFT_87475, partial [Bipolaris oryzae ATCC 44560] gi|578494853|gb|EUN32238.1| hypothetical protein COCVIDRAFT_85825, partial [Bipolaris victoriae FI3] Length = 81 Score = 120 bits (300), Expect = 5e-25 Identities = 55/58 (94%), Positives = 57/58 (98%) Frame = -3 Query: 261 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA 88 SQHNQ+KK H+NGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA Sbjct: 24 SQHNQSKKNHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA 81 >gb|EME39946.1| hypothetical protein DOTSEDRAFT_47443 [Dothistroma septosporum NZE10] Length = 65 Score = 119 bits (297), Expect = 1e-24 Identities = 53/58 (91%), Positives = 58/58 (100%) Frame = -3 Query: 261 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA 88 SQHNQ+KKAH+NGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTM+ALKEVKEGKR++A Sbjct: 8 SQHNQSKKAHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 65 >ref|XP_003303931.1| 60S ribosomal protein L29 [Pyrenophora teres f. teres 0-1] gi|311319731|gb|EFQ87950.1| hypothetical protein PTT_16333 [Pyrenophora teres f. teres 0-1] Length = 65 Score = 119 bits (297), Expect = 1e-24 Identities = 54/58 (93%), Positives = 57/58 (98%) Frame = -3 Query: 261 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA 88 SQHNQ+KK H+NGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKR+SA Sbjct: 8 SQHNQSKKNHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRDSA 65 >ref|XP_002846081.1| 60S ribosomal protein L29 [Arthroderma otae CBS 113480] gi|238843469|gb|EEQ33131.1| conserved hypothetical protein [Arthroderma otae CBS 113480] gi|326476329|gb|EGE00339.1| 60S ribosomal protein L29 [Trichophyton tonsurans CBS 112818] gi|607892685|gb|EZF32010.1| 60S ribosomal protein L29 [Trichophyton interdigitale H6] gi|607943201|gb|EZF76196.1| 60S ribosomal protein L29 [Trichophyton soudanense CBS 452.61] gi|607979708|gb|EZG08705.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 735.88] gi|633050504|gb|KDB26484.1| 60S ribosomal protein L29 [Trichophyton interdigitale MR816] Length = 65 Score = 119 bits (297), Expect = 1e-24 Identities = 54/58 (93%), Positives = 57/58 (98%) Frame = -3 Query: 261 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA 88 SQHNQ KKAH+NGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTM+ALKEVKEGKR+SA Sbjct: 8 SQHNQNKKAHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDSA 65 >ref|XP_001936717.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983816|gb|EDU49304.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 111 Score = 119 bits (297), Expect = 1e-24 Identities = 54/58 (93%), Positives = 57/58 (98%) Frame = -3 Query: 261 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA 88 SQHNQ+KK H+NGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKR+SA Sbjct: 54 SQHNQSKKNHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRDSA 111 >gb|KIW48209.1| 60S ribosomal protein L29 [Exophiala oligosperma] Length = 113 Score = 118 bits (296), Expect = 1e-24 Identities = 53/57 (92%), Positives = 57/57 (100%) Frame = -3 Query: 261 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRES 91 SQHNQAKKAH+NGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTM+ALKEVKEGKR++ Sbjct: 56 SQHNQAKKAHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDA 112 >ref|XP_001245359.1| 60S ribosomal protein L29 [Coccidioides immitis RS] gi|258566009|ref|XP_002583749.1| predicted protein [Uncinocarpus reesii 1704] gi|303323027|ref|XP_003071505.1| 60S ribosomal protein L29 [Coccidioides posadasii C735 delta SOWgp] gi|237907450|gb|EEP81851.1| predicted protein [Uncinocarpus reesii 1704] gi|240111207|gb|EER29360.1| 60S ribosomal protein L29, putative [Coccidioides posadasii C735 delta SOWgp] gi|320033315|gb|EFW15263.1| conserved hypothetical protein [Coccidioides posadasii str. Silveira] gi|767020164|gb|EAS33776.3| 60S ribosomal protein L29 [Coccidioides immitis RS] gi|855535657|gb|KMM70306.1| hypothetical protein CPAG_06618 [Coccidioides posadasii RMSCC 3488] gi|859410785|gb|KMP04971.1| hypothetical protein CIRG_04652 [Coccidioides immitis RMSCC 2394] gi|875284439|gb|KMU78166.1| hypothetical protein CISG_07006 [Coccidioides immitis RMSCC 3703] gi|875640708|gb|KMU86473.1| hypothetical protein CIHG_04262 [Coccidioides immitis H538.4] Length = 65 Score = 118 bits (295), Expect = 2e-24 Identities = 54/58 (93%), Positives = 56/58 (96%) Frame = -3 Query: 261 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA 88 SQHNQ KKAH+NGIKKPKTHRYPSLKG DPKFRRNHRHALHGTM+ALKEVKEGKRESA Sbjct: 8 SQHNQNKKAHRNGIKKPKTHRYPSLKGVDPKFRRNHRHALHGTMKALKEVKEGKRESA 65 >ref|XP_007732328.1| large subunit ribosomal protein L29e [Capronia epimyces CBS 606.96] gi|590011845|gb|EXJ87049.1| large subunit ribosomal protein L29e [Capronia epimyces CBS 606.96] Length = 65 Score = 117 bits (294), Expect = 2e-24 Identities = 53/58 (91%), Positives = 57/58 (98%) Frame = -3 Query: 261 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA 88 SQHNQ+KKAH+NGIKKPKTHRYPSL GTDPKFRRNHRHALHGTM+ALKEVKEGKRE+A Sbjct: 8 SQHNQSKKAHRNGIKKPKTHRYPSLAGTDPKFRRNHRHALHGTMKALKEVKEGKREAA 65 >ref|XP_007784263.1| 60S ribosomal protein L29 [Coniosporium apollinis CBS 100218] gi|494832780|gb|EON68946.1| 60S ribosomal protein L29 [Coniosporium apollinis CBS 100218] Length = 65 Score = 117 bits (294), Expect = 2e-24 Identities = 54/58 (93%), Positives = 56/58 (96%) Frame = -3 Query: 261 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA 88 SQHNQ KK HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKR++A Sbjct: 8 SQHNQNKKDHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRDAA 65 >ref|XP_001805871.1| hypothetical protein SNOG_15733 [Phaeosphaeria nodorum SN15] gi|160705566|gb|EAT76828.2| hypothetical protein SNOG_15733 [Phaeosphaeria nodorum SN15] Length = 65 Score = 117 bits (294), Expect = 2e-24 Identities = 53/58 (91%), Positives = 57/58 (98%) Frame = -3 Query: 261 SQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA 88 SQHNQ+KK H+NGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTM+ALKEVKEGKR+SA Sbjct: 8 SQHNQSKKNHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDSA 65