BLASTX nr result
ID: Forsythia22_contig00028905
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00028905 (1289 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012852418.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-... 35 6e-06 >ref|XP_012852418.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like [Erythranthe guttatus] Length = 457 Score = 35.4 bits (80), Expect(3) = 6e-06 Identities = 21/61 (34%), Positives = 35/61 (57%) Frame = +1 Query: 574 PSKDQVRLEIVRILALQLASNPISRNWHV*LL*KNHTIGNVSAIVGFIKALVFTAKLGED 753 P KD++ +IV ++ALQ+ P +R + +H +G+ S+IVGF++A K D Sbjct: 140 PEKDELEYKIVPLIALQITLFP-NRGICIGFA-NHHCVGDASSIVGFVRAWASMNKCNGD 197 Query: 754 E 756 E Sbjct: 198 E 198 Score = 32.0 bits (71), Expect(3) = 6e-06 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = +3 Query: 477 SITESNKAFDFNLLTENNPRNADEFYSFVLSYP 575 +I ESN DF+ L N+ R+AD FY+FV +P Sbjct: 108 TIAESNND-DFDELITNHARDADRFYNFVPEFP 139 Score = 30.8 bits (68), Expect(3) = 6e-06 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +2 Query: 401 ERIIPNMKPSHPLTLEQFIPLAGNSIH 481 E ++PN+K S LTL+ ++P +GN ++ Sbjct: 59 ETLVPNLKESLSLTLKHYLPASGNLLY 85