BLASTX nr result
ID: Forsythia22_contig00028767
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00028767 (525 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008384050.1| PREDICTED: BTB/POZ and TAZ domain-containing... 69 1e-09 ref|XP_009366232.1| PREDICTED: BTB/POZ and TAZ domain-containing... 66 1e-08 ref|XP_011073991.1| PREDICTED: BTB/POZ and TAZ domain-containing... 63 7e-08 ref|XP_008394273.1| PREDICTED: BTB/POZ and TAZ domain-containing... 63 9e-08 ref|XP_008394271.1| PREDICTED: BTB/POZ and TAZ domain-containing... 63 9e-08 ref|XP_010101356.1| BTB/POZ and TAZ domain-containing protein 3 ... 62 1e-07 ref|XP_009780836.1| PREDICTED: BTB/POZ and TAZ domain-containing... 61 3e-07 emb|CDP08065.1| unnamed protein product [Coffea canephora] 60 6e-07 ref|XP_007202092.1| hypothetical protein PRUPE_ppa007476mg [Prun... 60 6e-07 ref|XP_012075384.1| PREDICTED: BTB/POZ and TAZ domain-containing... 60 7e-07 ref|XP_012839051.1| PREDICTED: BTB/POZ and TAZ domain-containing... 59 1e-06 ref|XP_006442138.1| hypothetical protein CICLE_v10020409mg [Citr... 59 1e-06 ref|XP_009358386.1| PREDICTED: BTB/POZ and TAZ domain-containing... 57 4e-06 ref|XP_008243049.1| PREDICTED: BTB/POZ and TAZ domain-containing... 57 5e-06 ref|XP_004287161.1| PREDICTED: BTB/POZ and TAZ domain-containing... 57 6e-06 >ref|XP_008384050.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Malus domestica] gi|657946295|ref|XP_008384056.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Malus domestica] Length = 407 Score = 68.9 bits (167), Expect = 1e-09 Identities = 38/83 (45%), Positives = 46/83 (55%) Frame = -1 Query: 249 MAYMDLDTPWPSSIMESFDRSFNIRIEEGNSAETLDFVEIPNSSTCYNHDIXXXXXXXXX 70 MA D+PWPSS +SF SFNI IEE N + L +E P SST Y+H+I Sbjct: 1 MASSTPDSPWPSSTHDSFSGSFNIHIEEANPDDILPVLEDPTSSTSYSHNIPKPPPVPSK 60 Query: 69 XXXKMKNHKGLADSCCVPNETKD 1 + K K L+ SC VPNET D Sbjct: 61 AYTQNKLFKRLSQSCYVPNETID 83 >ref|XP_009366232.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Pyrus x bretschneideri] gi|694380173|ref|XP_009366233.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Pyrus x bretschneideri] Length = 407 Score = 65.9 bits (159), Expect = 1e-08 Identities = 37/83 (44%), Positives = 45/83 (54%) Frame = -1 Query: 249 MAYMDLDTPWPSSIMESFDRSFNIRIEEGNSAETLDFVEIPNSSTCYNHDIXXXXXXXXX 70 MA D+PWPSS +SF SFNI IEE N + L +E P SST Y+H+I Sbjct: 1 MASSTPDSPWPSSTHDSFSGSFNIHIEEVNPDDILPVLEDPTSSTSYSHNIPKPPPVPSK 60 Query: 69 XXXKMKNHKGLADSCCVPNETKD 1 + K L+ SC VPNET D Sbjct: 61 AYTQNKLFNRLSQSCYVPNETID 83 >ref|XP_011073991.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Sesamum indicum] gi|747055503|ref|XP_011073992.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Sesamum indicum] Length = 408 Score = 63.2 bits (152), Expect = 7e-08 Identities = 34/79 (43%), Positives = 48/79 (60%), Gaps = 1/79 (1%) Frame = -1 Query: 234 LDTPWPSSIMESFDRSFNIRIEEGNSAETLDFVEIPNSSTCYNHDIXXXXXXXXXXXXKM 55 +D WPSS +ESFDR F+I+IEEGNS+ L +V+ S+ ++H+I Sbjct: 6 VDISWPSSFIESFDRPFDIQIEEGNSSTALTYVDDTKLSSFHHHNI------PKPPPPPR 59 Query: 54 KN-HKGLADSCCVPNETKD 1 KN ++GLA C +P ETKD Sbjct: 60 KNLNRGLAKHCSIPQETKD 78 >ref|XP_008394273.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like isoform X2 [Malus domestica] Length = 395 Score = 62.8 bits (151), Expect = 9e-08 Identities = 35/83 (42%), Positives = 45/83 (54%) Frame = -1 Query: 249 MAYMDLDTPWPSSIMESFDRSFNIRIEEGNSAETLDFVEIPNSSTCYNHDIXXXXXXXXX 70 MA LD+PWPSS E+F SFNI IEE N + L +E P SS +H+I Sbjct: 1 MASPTLDSPWPSSTSETFSGSFNISIEEENPDDILPVLEDPTSSMSCSHNIPKPPPVPSK 60 Query: 69 XXXKMKNHKGLADSCCVPNETKD 1 + K+ K L+ C VP+ET D Sbjct: 61 AYTQNKHFKRLSQRCYVPDETLD 83 >ref|XP_008394271.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like isoform X1 [Malus domestica] gi|658003517|ref|XP_008394272.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like isoform X1 [Malus domestica] Length = 407 Score = 62.8 bits (151), Expect = 9e-08 Identities = 35/83 (42%), Positives = 45/83 (54%) Frame = -1 Query: 249 MAYMDLDTPWPSSIMESFDRSFNIRIEEGNSAETLDFVEIPNSSTCYNHDIXXXXXXXXX 70 MA LD+PWPSS E+F SFNI IEE N + L +E P SS +H+I Sbjct: 1 MASPTLDSPWPSSTSETFSGSFNISIEEENPDDILPVLEDPTSSMSCSHNIPKPPPVPSK 60 Query: 69 XXXKMKNHKGLADSCCVPNETKD 1 + K+ K L+ C VP+ET D Sbjct: 61 AYTQNKHFKRLSQRCYVPDETLD 83 >ref|XP_010101356.1| BTB/POZ and TAZ domain-containing protein 3 [Morus notabilis] gi|587899932|gb|EXB88303.1| BTB/POZ and TAZ domain-containing protein 3 [Morus notabilis] Length = 812 Score = 62.0 bits (149), Expect = 1e-07 Identities = 36/83 (43%), Positives = 44/83 (53%) Frame = -1 Query: 249 MAYMDLDTPWPSSIMESFDRSFNIRIEEGNSAETLDFVEIPNSSTCYNHDIXXXXXXXXX 70 MA DLD+ WPSS SF S +IR+EE NSA+ L +E P SS YN +I Sbjct: 1 MASPDLDSTWPSSSGYSFSGSLDIRLEEANSADILPVLEAPTSSVSYNCNIPKPPPLPNK 60 Query: 69 XXXKMKNHKGLADSCCVPNETKD 1 + K L+D C VP ET D Sbjct: 61 IITRTKYVNRLSDFCPVPKETVD 83 >ref|XP_009780836.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Nicotiana sylvestris] gi|698457435|ref|XP_009780837.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Nicotiana sylvestris] gi|698457438|ref|XP_009780838.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Nicotiana sylvestris] gi|698457442|ref|XP_009780839.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Nicotiana sylvestris] Length = 402 Score = 60.8 bits (146), Expect = 3e-07 Identities = 34/83 (40%), Positives = 46/83 (55%) Frame = -1 Query: 249 MAYMDLDTPWPSSIMESFDRSFNIRIEEGNSAETLDFVEIPNSSTCYNHDIXXXXXXXXX 70 MA D+ TPW SS +ESF SF IRIEE + ++++F E P+S C +I Sbjct: 1 MASPDVHTPWLSSAVESFGGSFKIRIEEEETVDSIEFFEDPSSLACNLPNIPNPPSAPGK 60 Query: 69 XXXKMKNHKGLADSCCVPNETKD 1 K N + L++S CVP E KD Sbjct: 61 IRSKATNPRQLSNSDCVPKEAKD 83 >emb|CDP08065.1| unnamed protein product [Coffea canephora] Length = 407 Score = 60.1 bits (144), Expect = 6e-07 Identities = 34/83 (40%), Positives = 47/83 (56%) Frame = -1 Query: 249 MAYMDLDTPWPSSIMESFDRSFNIRIEEGNSAETLDFVEIPNSSTCYNHDIXXXXXXXXX 70 MA +DLDTPW +S +ESFD S +I IEE +S+ +LD ++ S + I Sbjct: 1 MASLDLDTPWLASSIESFDGSLDIHIEEVSSSASLDSLDKSKSIIHCSQTIPKPPPLPAK 60 Query: 69 XXXKMKNHKGLADSCCVPNETKD 1 + KN + L+ SC VP ETKD Sbjct: 61 ICQRTKNQRCLSKSCFVPKETKD 83 >ref|XP_007202092.1| hypothetical protein PRUPE_ppa007476mg [Prunus persica] gi|462397623|gb|EMJ03291.1| hypothetical protein PRUPE_ppa007476mg [Prunus persica] Length = 366 Score = 60.1 bits (144), Expect = 6e-07 Identities = 38/84 (45%), Positives = 43/84 (51%), Gaps = 1/84 (1%) Frame = -1 Query: 249 MAYMDLDTPWPSSIMESFDRSFNIRIEEGNSAETLDFVEIPNSSTCYNHDIXXXXXXXXX 70 MA LD+PWPSS +SF SFNIRIE E L +E P SS YNH+I Sbjct: 1 MASPTLDSPWPSSPSDSFCGSFNIRIEGEIPDEILPVLEDPTSSVSYNHNIPKPPPPVPS 60 Query: 69 XXXKM-KNHKGLADSCCVPNETKD 1 K K L+ SC VP ET D Sbjct: 61 KIYSWNKYFKRLSRSCSVPKETMD 84 >ref|XP_012075384.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Jatropha curcas] gi|802616768|ref|XP_012075385.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Jatropha curcas] gi|643726426|gb|KDP35133.1| hypothetical protein JCGZ_10667 [Jatropha curcas] Length = 411 Score = 59.7 bits (143), Expect = 7e-07 Identities = 32/83 (38%), Positives = 44/83 (53%) Frame = -1 Query: 249 MAYMDLDTPWPSSIMESFDRSFNIRIEEGNSAETLDFVEIPNSSTCYNHDIXXXXXXXXX 70 MA DLD+ W S+ ES R FNI +E NSA+ L ++ P SS Y++ I Sbjct: 1 MASPDLDSSWLSAAGESVGRCFNIHMEGANSADVLRVLDCPTSSRSYSNSIPKPPPLPNK 60 Query: 69 XXXKMKNHKGLADSCCVPNETKD 1 + + K ++D CCVP E KD Sbjct: 61 ILTRDNSCKRISDCCCVPKEIKD 83 >ref|XP_012839051.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Erythranthe guttatus] gi|848877224|ref|XP_012839052.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Erythranthe guttatus] gi|848877226|ref|XP_012839053.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Erythranthe guttatus] gi|604331811|gb|EYU36669.1| hypothetical protein MIMGU_mgv1a007664mg [Erythranthe guttata] Length = 399 Score = 59.3 bits (142), Expect = 1e-06 Identities = 33/77 (42%), Positives = 45/77 (58%) Frame = -1 Query: 231 DTPWPSSIMESFDRSFNIRIEEGNSAETLDFVEIPNSSTCYNHDIXXXXXXXXXXXXKMK 52 D WPSS++ESFDRSF+I IEEGNS++ F+E S +H+I + K Sbjct: 7 DISWPSSVIESFDRSFDINIEEGNSSDISYFLEDKMPSPNNHHNI-----PKPPPLPRKK 61 Query: 51 NHKGLADSCCVPNETKD 1 ++GL C VP ET+D Sbjct: 62 LNRGLPKHCFVPKETRD 78 >ref|XP_006442138.1| hypothetical protein CICLE_v10020409mg [Citrus clementina] gi|567899302|ref|XP_006442139.1| hypothetical protein CICLE_v10020409mg [Citrus clementina] gi|557544400|gb|ESR55378.1| hypothetical protein CICLE_v10020409mg [Citrus clementina] gi|557544401|gb|ESR55379.1| hypothetical protein CICLE_v10020409mg [Citrus clementina] Length = 407 Score = 59.3 bits (142), Expect = 1e-06 Identities = 34/83 (40%), Positives = 43/83 (51%) Frame = -1 Query: 249 MAYMDLDTPWPSSIMESFDRSFNIRIEEGNSAETLDFVEIPNSSTCYNHDIXXXXXXXXX 70 MA D+++PW + ESF SFNIR+EEGN+A+ L +E+P SS YN I Sbjct: 1 MASPDIESPWLCAAGESFCGSFNIRVEEGNAADILHVLEVPTSSVTYNCSIPKPPPLPIK 60 Query: 69 XXXKMKNHKGLADSCCVPNETKD 1 K K VP ETKD Sbjct: 61 PCTKNKYPNRFLHCSFVPKETKD 83 >ref|XP_009358386.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Pyrus x bretschneideri] Length = 407 Score = 57.4 bits (137), Expect = 4e-06 Identities = 33/78 (42%), Positives = 42/78 (53%) Frame = -1 Query: 234 LDTPWPSSIMESFDRSFNIRIEEGNSAETLDFVEIPNSSTCYNHDIXXXXXXXXXXXXKM 55 LD+P PSS E+F SFNI IEE N + L +E P SS +H+I + Sbjct: 6 LDSPCPSSTSETFSGSFNISIEEENPDDILPVLEDPTSSMSCSHNIPKPPPVPSKAYTQN 65 Query: 54 KNHKGLADSCCVPNETKD 1 K+ K L+ C VPNET D Sbjct: 66 KHLKRLSQHCYVPNETLD 83 >ref|XP_008243049.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Prunus mume] gi|645275933|ref|XP_008243050.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Prunus mume] Length = 406 Score = 57.0 bits (136), Expect = 5e-06 Identities = 37/84 (44%), Positives = 42/84 (50%), Gaps = 1/84 (1%) Frame = -1 Query: 249 MAYMDLDTPWPSSIMESFDRSFNIRIEEGNSAETLDFVEIPNSSTCYNHDIXXXXXXXXX 70 MA LD+PW SS +SF SFNIRIE E L +E P SS YNH+I Sbjct: 1 MASPTLDSPWSSSPSDSFCGSFNIRIEGEIPDEILPVLEDPTSSVSYNHNIPKPPPPVPS 60 Query: 69 XXXKM-KNHKGLADSCCVPNETKD 1 K K L+ SC VP ET D Sbjct: 61 KTYSWNKYFKRLSRSCSVPKETMD 84 >ref|XP_004287161.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Fragaria vesca subsp. vesca] Length = 409 Score = 56.6 bits (135), Expect = 6e-06 Identities = 35/85 (41%), Positives = 44/85 (51%), Gaps = 1/85 (1%) Frame = -1 Query: 252 VMAYMDLDTPWPSSIMES-FDRSFNIRIEEGNSAETLDFVEIPNSSTCYNHDIXXXXXXX 76 +MA LD+PWP+S ES F SFNI +EE A+ + +E P SS Y+H I Sbjct: 1 MMASPALDSPWPTSARESLFCGSFNIHMEEEIPADIIPVLEDPTSSVSYSHTIPKPPPVP 60 Query: 75 XXXXXKMKNHKGLADSCCVPNETKD 1 K K L+ SC VP ET D Sbjct: 61 INAYAGNKYIKRLSGSCSVPKETID 85