BLASTX nr result
ID: Forsythia22_contig00028683
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00028683 (802 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012841688.1| PREDICTED: uncharacterized protein LOC105961... 68 8e-09 >ref|XP_012841688.1| PREDICTED: uncharacterized protein LOC105961976 [Erythranthe guttatus] gi|604327886|gb|EYU33554.1| hypothetical protein MIMGU_mgv1a014008mg [Erythranthe guttata] Length = 203 Score = 67.8 bits (164), Expect = 8e-09 Identities = 37/62 (59%), Positives = 45/62 (72%), Gaps = 5/62 (8%) Frame = -2 Query: 801 FFNSTTE---QNAPDITQVKNACRTSYNYGSAAFIKIDNAVR-DGLQRL-KQWLPYDETK 637 F ST E +NAPD T +K ACR SYNYGSAA K+D AVR DG+ +L ++W+P DETK Sbjct: 6 FIGSTAESVKRNAPDATPLKIACRNSYNYGSAALAKLDQAVRIDGVYQLRRRWIPDDETK 65 Query: 636 SK 631 SK Sbjct: 66 SK 67