BLASTX nr result
ID: Forsythia22_contig00028674
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00028674 (214 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098409.1| PREDICTED: uncharacterized protein LOC105177... 61 3e-07 >ref|XP_011098409.1| PREDICTED: uncharacterized protein LOC105177084 [Sesamum indicum] Length = 931 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/72 (41%), Positives = 47/72 (65%), Gaps = 2/72 (2%) Frame = -2 Query: 213 AWGNAVPIFVGNEIYDQSGVVI-VDSIESEGGFETIAEADKKTN-GPLNISYKLSFNLFP 40 AWG+AVP+ VG+++Y+ +++ VDS+ GF I+E + N GPLNISY++S N +P Sbjct: 466 AWGSAVPVSVGDQLYETRNMLVAVDSVAFAPGFAAISEPEMSANKGPLNISYRISINPYP 525 Query: 39 QEKLGAWFSPLN 4 + + F LN Sbjct: 526 EVESSDLFRALN 537