BLASTX nr result
ID: Forsythia22_contig00028530
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00028530 (359 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AJT59724.1| efflux facilitator PIN2 [Nicotiana tabacum] 85 2e-14 gb|AJT59723.1| efflux facilitator PIN2 [Nicotiana tabacum] 85 2e-14 ref|XP_011069941.1| PREDICTED: auxin efflux carrier component 2 ... 85 2e-14 ref|XP_010246122.1| PREDICTED: auxin efflux carrier component 2-... 85 2e-14 ref|XP_009763716.1| PREDICTED: auxin efflux carrier component 2,... 85 2e-14 ref|XP_009610818.1| PREDICTED: auxin efflux carrier component 2 ... 85 2e-14 emb|CDP03009.1| unnamed protein product [Coffea canephora] 85 2e-14 ref|XP_004299793.1| PREDICTED: auxin efflux carrier component 2-... 85 2e-14 ref|XP_012837572.1| PREDICTED: auxin efflux carrier component 2 ... 84 3e-14 ref|XP_012448077.1| PREDICTED: auxin efflux carrier component 2 ... 84 3e-14 ref|XP_011017712.1| PREDICTED: auxin efflux carrier component 2 ... 84 3e-14 ref|XP_010246119.1| PREDICTED: auxin efflux carrier component 2-... 84 3e-14 ref|XP_010046903.1| PREDICTED: LOW QUALITY PROTEIN: auxin efflux... 84 3e-14 gb|KDO61974.1| hypothetical protein CISIN_1g036474mg [Citrus sin... 84 3e-14 gb|KCW78612.1| hypothetical protein EUGRSUZ_C00078 [Eucalyptus g... 84 3e-14 gb|EYU37304.1| hypothetical protein MIMGU_mgv1a002534mg [Erythra... 84 3e-14 ref|XP_006474301.1| PREDICTED: auxin efflux carrier component 2-... 84 3e-14 ref|XP_006401246.1| hypothetical protein EUTSA_v10012929mg [Eutr... 84 3e-14 ref|XP_007014497.1| Auxin efflux carrier family protein [Theobro... 84 3e-14 ref|NP_568848.1| auxin efflux carrier component 2 [Arabidopsis t... 84 4e-14 >gb|AJT59724.1| efflux facilitator PIN2 [Nicotiana tabacum] Length = 618 Score = 84.7 bits (208), Expect = 2e-14 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 2 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 127 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI Sbjct: 569 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 610 >gb|AJT59723.1| efflux facilitator PIN2 [Nicotiana tabacum] Length = 583 Score = 84.7 bits (208), Expect = 2e-14 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 2 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 127 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI Sbjct: 534 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 575 >ref|XP_011069941.1| PREDICTED: auxin efflux carrier component 2 [Sesamum indicum] Length = 626 Score = 84.7 bits (208), Expect = 2e-14 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 2 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 127 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI Sbjct: 577 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 618 >ref|XP_010246122.1| PREDICTED: auxin efflux carrier component 2-like [Nelumbo nucifera] Length = 634 Score = 84.7 bits (208), Expect = 2e-14 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 2 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 127 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI Sbjct: 585 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 626 >ref|XP_009763716.1| PREDICTED: auxin efflux carrier component 2, partial [Nicotiana sylvestris] Length = 627 Score = 84.7 bits (208), Expect = 2e-14 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 2 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 127 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI Sbjct: 578 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 619 >ref|XP_009610818.1| PREDICTED: auxin efflux carrier component 2 [Nicotiana tomentosiformis] Length = 654 Score = 84.7 bits (208), Expect = 2e-14 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 2 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 127 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI Sbjct: 605 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 646 >emb|CDP03009.1| unnamed protein product [Coffea canephora] Length = 618 Score = 84.7 bits (208), Expect = 2e-14 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 2 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 127 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI Sbjct: 569 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 610 >ref|XP_004299793.1| PREDICTED: auxin efflux carrier component 2-like [Fragaria vesca subsp. vesca] Length = 646 Score = 84.7 bits (208), Expect = 2e-14 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 2 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 127 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI Sbjct: 597 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 638 >ref|XP_012837572.1| PREDICTED: auxin efflux carrier component 2 [Erythranthe guttatus] Length = 678 Score = 84.3 bits (207), Expect = 3e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +2 Query: 2 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 127 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGML+ALPITI Sbjct: 629 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLIALPITI 670 >ref|XP_012448077.1| PREDICTED: auxin efflux carrier component 2 [Gossypium raimondii] gi|763786699|gb|KJB53695.1| hypothetical protein B456_009G001600 [Gossypium raimondii] Length = 630 Score = 84.3 bits (207), Expect = 3e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +2 Query: 2 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 127 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGML+ALPITI Sbjct: 581 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLIALPITI 622 >ref|XP_011017712.1| PREDICTED: auxin efflux carrier component 2 [Populus euphratica] Length = 634 Score = 84.3 bits (207), Expect = 3e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +2 Query: 2 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 127 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGML+ALPITI Sbjct: 585 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLIALPITI 626 >ref|XP_010246119.1| PREDICTED: auxin efflux carrier component 2-like [Nelumbo nucifera] gi|720093663|ref|XP_010246120.1| PREDICTED: auxin efflux carrier component 2-like [Nelumbo nucifera] gi|720093666|ref|XP_010246121.1| PREDICTED: auxin efflux carrier component 2-like [Nelumbo nucifera] Length = 633 Score = 84.3 bits (207), Expect = 3e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +2 Query: 2 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 127 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGML+ALPITI Sbjct: 584 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLIALPITI 625 >ref|XP_010046903.1| PREDICTED: LOW QUALITY PROTEIN: auxin efflux carrier component 2-like [Eucalyptus grandis] Length = 654 Score = 84.3 bits (207), Expect = 3e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +2 Query: 2 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 127 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGML+ALPITI Sbjct: 605 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLIALPITI 646 >gb|KDO61974.1| hypothetical protein CISIN_1g036474mg [Citrus sinensis] Length = 646 Score = 84.3 bits (207), Expect = 3e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +2 Query: 2 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 127 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGML+ALPITI Sbjct: 597 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLIALPITI 638 >gb|KCW78612.1| hypothetical protein EUGRSUZ_C00078 [Eucalyptus grandis] Length = 626 Score = 84.3 bits (207), Expect = 3e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +2 Query: 2 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 127 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGML+ALPITI Sbjct: 577 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLIALPITI 618 >gb|EYU37304.1| hypothetical protein MIMGU_mgv1a002534mg [Erythranthe guttata] Length = 662 Score = 84.3 bits (207), Expect = 3e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +2 Query: 2 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 127 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGML+ALPITI Sbjct: 613 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLIALPITI 654 >ref|XP_006474301.1| PREDICTED: auxin efflux carrier component 2-like [Citrus sinensis] Length = 646 Score = 84.3 bits (207), Expect = 3e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +2 Query: 2 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 127 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGML+ALPITI Sbjct: 597 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLIALPITI 638 >ref|XP_006401246.1| hypothetical protein EUTSA_v10012929mg [Eutrema salsugineum] gi|557102336|gb|ESQ42699.1| hypothetical protein EUTSA_v10012929mg [Eutrema salsugineum] Length = 648 Score = 84.3 bits (207), Expect = 3e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +2 Query: 2 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 127 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALP+TI Sbjct: 597 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPVTI 638 >ref|XP_007014497.1| Auxin efflux carrier family protein [Theobroma cacao] gi|508784860|gb|EOY32116.1| Auxin efflux carrier family protein [Theobroma cacao] Length = 634 Score = 84.3 bits (207), Expect = 3e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +2 Query: 2 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 127 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGML+ALPITI Sbjct: 585 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLIALPITI 626 >ref|NP_568848.1| auxin efflux carrier component 2 [Arabidopsis thaliana] gi|42558886|sp|Q9LU77.2|PIN2_ARATH RecName: Full=Auxin efflux carrier component 2; Short=AtPIN2; AltName: Full=Auxin efflux carrier AGR; AltName: Full=Ethylene-insensitive root 1; Short=AtEIR1; AltName: Full=Polar-auxin-transport efflux component AGR1; AltName: Full=Protein AGRAVITROPIC 1; Short=AtAGR1; AltName: Full=Protein WAVY 6 gi|3377507|gb|AAC39513.1| auxin transport protein EIR1 [Arabidopsis thaliana] gi|3661620|gb|AAC61781.1| putative auxin efflux carrier AGR [Arabidopsis thaliana] gi|3746886|gb|AAC84042.1| polar-auxin-transport efflux component AGRAVITROPIC 1 [Arabidopsis thaliana] gi|4206709|gb|AAD11780.1| root gravitropism control protein [Arabidopsis thaliana] gi|19310454|gb|AAL84962.1| AT5g57090/MUL3_3 [Arabidopsis thaliana] gi|24797062|gb|AAN64543.1| At5g57090/MUL3_3 [Arabidopsis thaliana] gi|51970858|dbj|BAD44121.1| root gravitropism control protein (PIN2) [Arabidopsis thaliana] gi|332009462|gb|AED96845.1| auxin efflux carrier component 2 [Arabidopsis thaliana] Length = 647 Score = 84.0 bits (206), Expect = 4e-14 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = +2 Query: 2 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITI 127 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALP+T+ Sbjct: 598 IVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPVTV 639