BLASTX nr result
ID: Forsythia22_contig00028038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00028038 (293 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011101125.1| PREDICTED: uncharacterized protein LOC105179... 66 8e-09 ref|XP_012829900.1| PREDICTED: uncharacterized protein LOC105951... 58 3e-06 >ref|XP_011101125.1| PREDICTED: uncharacterized protein LOC105179223 [Sesamum indicum] Length = 172 Score = 66.2 bits (160), Expect = 8e-09 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = -3 Query: 291 LSKWETSAIKIFKVAAVLLGVVVQIFTIVVTSSLMHNMSPPKRAS 157 LS+WETS ++ K+AAV+LGV+VQIF I V +SL+HNM+PPKRAS Sbjct: 128 LSRWETSKFELLKIAAVVLGVLVQIFAIAVGTSLIHNMAPPKRAS 172 >ref|XP_012829900.1| PREDICTED: uncharacterized protein LOC105951055 [Erythranthe guttatus] gi|604344851|gb|EYU43525.1| hypothetical protein MIMGU_mgv1a014951mg [Erythranthe guttata] Length = 172 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/44 (56%), Positives = 36/44 (81%) Frame = -3 Query: 291 LSKWETSAIKIFKVAAVLLGVVVQIFTIVVTSSLMHNMSPPKRA 160 LS W++S ++ K+AAVLLG++VQI+ V +SL+HNM+PPKRA Sbjct: 129 LSTWQSSKFELLKIAAVLLGMLVQIYATSVATSLIHNMAPPKRA 172