BLASTX nr result
ID: Forsythia22_contig00027720
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00027720 (515 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP01597.1| unnamed protein product [Coffea canephora] 74 5e-11 ref|XP_009786070.1| PREDICTED: uncharacterized protein LOC104234... 57 5e-06 >emb|CDP01597.1| unnamed protein product [Coffea canephora] Length = 49 Score = 73.6 bits (179), Expect = 5e-11 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -2 Query: 427 MAKKINHIDSWIEVAPSPLLVPHKPSHSPKLETIKEDRAEGQDD 296 MAKK+ H+ SW+EVAPSP ++P KPSHSPKLETI EDRAEG+DD Sbjct: 1 MAKKMMHMKSWMEVAPSPSVLPLKPSHSPKLETISEDRAEGRDD 44 >ref|XP_009786070.1| PREDICTED: uncharacterized protein LOC104234228 [Nicotiana sylvestris] Length = 58 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = -2 Query: 427 MAKKINHIDSWIEVAPSPLLVPHKPSHSPKLETIKE-DRAEGQDD 296 MAKK+ ++ WIEVAP ++ P K SHSPKLETIKE DRAEGQ++ Sbjct: 7 MAKKVVNMKPWIEVAPPLVISPTKLSHSPKLETIKEDDRAEGQNE 51