BLASTX nr result
ID: Forsythia22_contig00027714
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00027714 (211 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB09735.1| hypothetical protein B456_001G161100 [Gossypium r... 78 3e-12 >gb|KJB09735.1| hypothetical protein B456_001G161100 [Gossypium raimondii] Length = 250 Score = 77.8 bits (190), Expect = 3e-12 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -3 Query: 209 PPNLYKVLLAFSQPLVAYVVVGIPTCSSLPPYLRIQRWPLD 87 PPNLYKVLLAFSQPLVAYVVVGIPTCSS PPYLRIQR PLD Sbjct: 13 PPNLYKVLLAFSQPLVAYVVVGIPTCSS-PPYLRIQRSPLD 52