BLASTX nr result
ID: Forsythia22_contig00027672
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00027672 (282 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009587919.1| PREDICTED: uncharacterized protein LOC104085... 63 7e-08 ref|XP_009587918.1| PREDICTED: uncharacterized protein LOC104085... 63 7e-08 ref|XP_009757734.1| PREDICTED: uncharacterized protein LOC104210... 62 1e-07 ref|XP_009757733.1| PREDICTED: uncharacterized protein LOC104210... 62 1e-07 ref|XP_012848854.1| PREDICTED: uncharacterized protein LOC105968... 57 6e-06 gb|EYU27390.1| hypothetical protein MIMGU_mgv1a001625mg [Erythra... 57 6e-06 >ref|XP_009587919.1| PREDICTED: uncharacterized protein LOC104085559 isoform X2 [Nicotiana tomentosiformis] Length = 833 Score = 63.2 bits (152), Expect = 7e-08 Identities = 35/60 (58%), Positives = 46/60 (76%) Frame = -2 Query: 182 MDSTVEIESGGRLEGVGEKRQAEGDVGLPKDGPPVKRIKGAGLIGNVKKVAEMVLVLAAM 3 MDSTV+I++ R +GVGEKR A DV L ++ P K+ +G+ +IG +KKVAEMVLVLAAM Sbjct: 1 MDSTVDIQAELRSDGVGEKRPAADDVEL-EEAPAPKKARGSMVIGTMKKVAEMVLVLAAM 59 >ref|XP_009587918.1| PREDICTED: uncharacterized protein LOC104085559 isoform X1 [Nicotiana tomentosiformis] Length = 852 Score = 63.2 bits (152), Expect = 7e-08 Identities = 35/60 (58%), Positives = 46/60 (76%) Frame = -2 Query: 182 MDSTVEIESGGRLEGVGEKRQAEGDVGLPKDGPPVKRIKGAGLIGNVKKVAEMVLVLAAM 3 MDSTV+I++ R +GVGEKR A DV L ++ P K+ +G+ +IG +KKVAEMVLVLAAM Sbjct: 1 MDSTVDIQAELRSDGVGEKRPAADDVEL-EEAPAPKKARGSMVIGTMKKVAEMVLVLAAM 59 >ref|XP_009757734.1| PREDICTED: uncharacterized protein LOC104210518 isoform X2 [Nicotiana sylvestris] Length = 730 Score = 62.4 bits (150), Expect = 1e-07 Identities = 34/60 (56%), Positives = 46/60 (76%) Frame = -2 Query: 182 MDSTVEIESGGRLEGVGEKRQAEGDVGLPKDGPPVKRIKGAGLIGNVKKVAEMVLVLAAM 3 MDSTV+I++ R +GVG+KR A DV L +D P K+ +G+ +IG +KKVAEMVLVLA+M Sbjct: 1 MDSTVDIQAELRSDGVGDKRPAADDVEL-EDAPAPKKARGSMVIGTMKKVAEMVLVLASM 59 >ref|XP_009757733.1| PREDICTED: uncharacterized protein LOC104210518 isoform X1 [Nicotiana sylvestris] Length = 832 Score = 62.4 bits (150), Expect = 1e-07 Identities = 34/60 (56%), Positives = 46/60 (76%) Frame = -2 Query: 182 MDSTVEIESGGRLEGVGEKRQAEGDVGLPKDGPPVKRIKGAGLIGNVKKVAEMVLVLAAM 3 MDSTV+I++ R +GVG+KR A DV L +D P K+ +G+ +IG +KKVAEMVLVLA+M Sbjct: 1 MDSTVDIQAELRSDGVGDKRPAADDVEL-EDAPAPKKARGSMVIGTMKKVAEMVLVLASM 59 >ref|XP_012848854.1| PREDICTED: uncharacterized protein LOC105968739 [Erythranthe guttatus] Length = 805 Score = 56.6 bits (135), Expect = 6e-06 Identities = 33/55 (60%), Positives = 38/55 (69%), Gaps = 3/55 (5%) Frame = -2 Query: 158 SGGRLEGVGEKRQAEGDVGLPKDGPPVKRIKG---AGLIGNVKKVAEMVLVLAAM 3 S R E VGEKR A DV + K+G P KRI+G +G+VKKVAEMVLVLAAM Sbjct: 11 SEARSEPVGEKRPASEDVDVLKEGSPHKRIRGESERSFVGDVKKVAEMVLVLAAM 65 >gb|EYU27390.1| hypothetical protein MIMGU_mgv1a001625mg [Erythranthe guttata] Length = 783 Score = 56.6 bits (135), Expect = 6e-06 Identities = 33/55 (60%), Positives = 38/55 (69%), Gaps = 3/55 (5%) Frame = -2 Query: 158 SGGRLEGVGEKRQAEGDVGLPKDGPPVKRIKG---AGLIGNVKKVAEMVLVLAAM 3 S R E VGEKR A DV + K+G P KRI+G +G+VKKVAEMVLVLAAM Sbjct: 4 SEARSEPVGEKRPASEDVDVLKEGSPHKRIRGESERSFVGDVKKVAEMVLVLAAM 58