BLASTX nr result
ID: Forsythia22_contig00024871
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00024871 (514 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011093165.1| PREDICTED: shaggy-related protein kinase alp... 64 4e-08 >ref|XP_011093165.1| PREDICTED: shaggy-related protein kinase alpha [Sesamum indicum] Length = 469 Score = 63.9 bits (154), Expect = 4e-08 Identities = 35/67 (52%), Positives = 48/67 (71%), Gaps = 1/67 (1%) Frame = -3 Query: 200 SNEGGDSGTK*VKVDQEIDTRVSCEVQS*KNSLRA*-QNTASKSLETVSNKSDVQGRPNK 24 S+ GDS K VKV+QE+D R SC+V++ +N L+A Q+ S SLE V++ S+V G+P K Sbjct: 18 SDPVGDSSIKRVKVEQELDHRDSCDVETGENCLQAPEQHMESNSLEAVASTSNVHGKPEK 77 Query: 23 SDYDELP 3 S YDELP Sbjct: 78 SGYDELP 84