BLASTX nr result
ID: Forsythia22_contig00024838
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00024838 (657 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010088771.1| hypothetical protein L484_018330 [Morus nota... 92 2e-16 >ref|XP_010088771.1| hypothetical protein L484_018330 [Morus notabilis] gi|587846476|gb|EXB36954.1| hypothetical protein L484_018330 [Morus notabilis] Length = 217 Score = 92.0 bits (227), Expect = 2e-16 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = +3 Query: 6 RPHCWKGSASKPYVELPPHTAPLGMEVGPAQACAVKVVVHD 128 RPHCWKGSASKPYVELPPHTAPLGMEVGP QACAVKVVVHD Sbjct: 55 RPHCWKGSASKPYVELPPHTAPLGMEVGPTQACAVKVVVHD 95