BLASTX nr result
ID: Forsythia22_contig00024796
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00024796 (438 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012837220.1| PREDICTED: pentatricopeptide repeat-containi... 76 8e-12 ref|XP_011088649.1| PREDICTED: pentatricopeptide repeat-containi... 71 3e-10 >ref|XP_012837220.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033 [Erythranthe guttatus] gi|604333640|gb|EYU37991.1| hypothetical protein MIMGU_mgv1a006093mg [Erythranthe guttata] Length = 458 Score = 76.3 bits (186), Expect = 8e-12 Identities = 43/68 (63%), Positives = 51/68 (75%) Frame = -3 Query: 280 MIGVCGLRLSAPPAKPAGCCRGRQYPLVFCDLTKQGHRLLSSIATAQDPSASIGLLRKFI 101 MIGVC ++LS A+P RQ P + C LTKQG RLLSSIAT++ PSA+I LLRKF+ Sbjct: 1 MIGVCSIQLSLS-ARPVSA-GFRQLPPLVCVLTKQGQRLLSSIATSEQPSAAISLLRKFV 58 Query: 100 ASSSKHVA 77 ASSSKHVA Sbjct: 59 ASSSKHVA 66 >ref|XP_011088649.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033 [Sesamum indicum] Length = 454 Score = 70.9 bits (172), Expect = 3e-10 Identities = 37/62 (59%), Positives = 43/62 (69%) Frame = -3 Query: 262 LRLSAPPAKPAGCCRGRQYPLVFCDLTKQGHRLLSSIATAQDPSASIGLLRKFIASSSKH 83 L LS PP A YP C LT+QGHR LSS+ T QDPSA++GLLRKF++SSSKH Sbjct: 7 LHLSPPPPPTAF----PHYPPFLCALTRQGHRFLSSLLTTQDPSAALGLLRKFVSSSSKH 62 Query: 82 VA 77 VA Sbjct: 63 VA 64