BLASTX nr result
ID: Forsythia22_contig00024549
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00024549 (227 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075261.1| PREDICTED: WD repeat-containing protein 48-l... 60 4e-14 emb|CDP08595.1| unnamed protein product [Coffea canephora] 60 6e-14 ref|XP_002512270.1| nucleotide binding protein, putative [Ricinu... 57 2e-13 emb|CBI34238.3| unnamed protein product [Vitis vinifera] 58 2e-13 ref|XP_002271491.1| PREDICTED: WD repeat-containing protein 48 [... 58 2e-13 ref|XP_008218170.1| PREDICTED: WD repeat-containing protein 48 [... 58 2e-13 ref|XP_006854552.1| PREDICTED: WD repeat-containing protein 48 [... 58 2e-13 ref|XP_007207140.1| hypothetical protein PRUPE_ppa001805mg [Prun... 58 2e-13 ref|XP_011032511.1| PREDICTED: WD repeat-containing protein 48-l... 57 4e-13 ref|XP_006382725.1| hypothetical protein POPTR_0005s04800g [Popu... 57 4e-13 ref|XP_012492919.1| PREDICTED: WD repeat-containing protein 48 i... 59 5e-13 ref|XP_012492920.1| PREDICTED: WD repeat-containing protein 48 h... 59 5e-13 gb|KJB45042.1| hypothetical protein B456_007G286900 [Gossypium r... 59 5e-13 ref|XP_011003807.1| PREDICTED: WD repeat-containing protein 48-l... 57 6e-13 ref|XP_006389300.1| hypothetical protein POPTR_0030s00210g [Popu... 57 6e-13 ref|XP_006389301.1| hypothetical protein POPTR_0030s00210g [Popu... 57 6e-13 ref|XP_007030678.1| Transducin/WD40 repeat-like superfamily prot... 58 8e-13 ref|XP_012463752.1| PREDICTED: WD repeat-containing protein 48-l... 58 8e-13 ref|XP_010905113.1| PREDICTED: WD repeat-containing protein 48-l... 56 8e-13 ref|XP_012463757.1| PREDICTED: WD repeat-containing protein 48-l... 58 8e-13 >ref|XP_011075261.1| PREDICTED: WD repeat-containing protein 48-like [Sesamum indicum] gi|747041815|ref|XP_011075271.1| PREDICTED: WD repeat-containing protein 48-like [Sesamum indicum] gi|747041817|ref|XP_011075276.1| PREDICTED: WD repeat-containing protein 48-like [Sesamum indicum] Length = 762 Score = 60.1 bits (144), Expect(2) = 4e-14 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = -2 Query: 166 EAWNCLSDGTCIMTFRQHFDYVTCLAAAENKMKTIA 59 + WNCLSDGTC TFRQH DYVTCLAAAE +A Sbjct: 108 KVWNCLSDGTCARTFRQHSDYVTCLAAAEKNSNVVA 143 Score = 44.3 bits (103), Expect(2) = 4e-14 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -1 Query: 71 ENNSKIVTSGGLGGEVFIWDLEA 3 E NS +V SGGLGGEVFIWDLEA Sbjct: 136 EKNSNVVASGGLGGEVFIWDLEA 158 >emb|CDP08595.1| unnamed protein product [Coffea canephora] Length = 762 Score = 60.5 bits (145), Expect(2) = 6e-14 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = -2 Query: 166 EAWNCLSDGTCIMTFRQHFDYVTCLAAAENKMKTIA 59 +AWNCLSDGTC+ T RQH DYVTCLAAAE +A Sbjct: 108 KAWNCLSDGTCVRTLRQHTDYVTCLAAAEKNSNIVA 143 Score = 43.1 bits (100), Expect(2) = 6e-14 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -1 Query: 71 ENNSKIVTSGGLGGEVFIWDLE 6 E NS IV SGGLGGEVFIWDLE Sbjct: 136 EKNSNIVASGGLGGEVFIWDLE 157 >ref|XP_002512270.1| nucleotide binding protein, putative [Ricinus communis] gi|223548231|gb|EEF49722.1| nucleotide binding protein, putative [Ricinus communis] Length = 764 Score = 57.4 bits (137), Expect(2) = 2e-13 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -2 Query: 166 EAWNCLSDGTCIMTFRQHFDYVTCLAAAENKMKTIA 59 + WNCLSDGTC T RQH DYVTCLAAAE +A Sbjct: 108 KTWNCLSDGTCTKTLRQHSDYVTCLAAAEKNSNIVA 143 Score = 44.7 bits (104), Expect(2) = 2e-13 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = -1 Query: 71 ENNSKIVTSGGLGGEVFIWDLEA 3 E NS IV SGGLGGEVFIWDLEA Sbjct: 136 EKNSNIVASGGLGGEVFIWDLEA 158 >emb|CBI34238.3| unnamed protein product [Vitis vinifera] Length = 781 Score = 57.8 bits (138), Expect(2) = 2e-13 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -2 Query: 166 EAWNCLSDGTCIMTFRQHFDYVTCLAAAENKMKTIA 59 + WNCLSDGTC T RQH DYVTCLAAAE +A Sbjct: 108 KTWNCLSDGTCTRTLRQHSDYVTCLAAAEKNSNVVA 143 Score = 43.9 bits (102), Expect(2) = 2e-13 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -1 Query: 71 ENNSKIVTSGGLGGEVFIWDLEA 3 E NS +V SGGLGGEVF+WDLEA Sbjct: 136 EKNSNVVASGGLGGEVFVWDLEA 158 >ref|XP_002271491.1| PREDICTED: WD repeat-containing protein 48 [Vitis vinifera] Length = 765 Score = 57.8 bits (138), Expect(2) = 2e-13 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -2 Query: 166 EAWNCLSDGTCIMTFRQHFDYVTCLAAAENKMKTIA 59 + WNCLSDGTC T RQH DYVTCLAAAE +A Sbjct: 108 KTWNCLSDGTCTRTLRQHSDYVTCLAAAEKNSNVVA 143 Score = 43.9 bits (102), Expect(2) = 2e-13 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -1 Query: 71 ENNSKIVTSGGLGGEVFIWDLEA 3 E NS +V SGGLGGEVF+WDLEA Sbjct: 136 EKNSNVVASGGLGGEVFVWDLEA 158 >ref|XP_008218170.1| PREDICTED: WD repeat-containing protein 48 [Prunus mume] Length = 763 Score = 57.8 bits (138), Expect(2) = 2e-13 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -2 Query: 166 EAWNCLSDGTCIMTFRQHFDYVTCLAAAENKMKTIA 59 + WNCLSDGTC T RQH DYVTCLAAAE +A Sbjct: 107 KTWNCLSDGTCTRTLRQHSDYVTCLAAAEKNSNVVA 142 Score = 43.9 bits (102), Expect(2) = 2e-13 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -1 Query: 71 ENNSKIVTSGGLGGEVFIWDLEA 3 E NS +V SGGLGGEVF+WDLEA Sbjct: 135 EKNSNVVASGGLGGEVFVWDLEA 157 >ref|XP_006854552.1| PREDICTED: WD repeat-containing protein 48 [Amborella trichopoda] gi|769799506|ref|XP_011627121.1| PREDICTED: WD repeat-containing protein 48 [Amborella trichopoda] gi|548858238|gb|ERN16019.1| hypothetical protein AMTR_s00030p00083820 [Amborella trichopoda] Length = 763 Score = 57.8 bits (138), Expect(2) = 2e-13 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = -2 Query: 166 EAWNCLSDGTCIMTFRQHFDYVTCLAAAENKMKTIA 59 + W+CLSDGTC TFRQH DYVTCLAAAE +A Sbjct: 107 KTWSCLSDGTCTRTFRQHSDYVTCLAAAEKNSNIVA 142 Score = 43.9 bits (102), Expect(2) = 2e-13 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -1 Query: 71 ENNSKIVTSGGLGGEVFIWDLEA 3 E NS IV SGGLGGEVFIWD+EA Sbjct: 135 EKNSNIVASGGLGGEVFIWDIEA 157 >ref|XP_007207140.1| hypothetical protein PRUPE_ppa001805mg [Prunus persica] gi|462402782|gb|EMJ08339.1| hypothetical protein PRUPE_ppa001805mg [Prunus persica] Length = 763 Score = 57.8 bits (138), Expect(2) = 2e-13 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -2 Query: 166 EAWNCLSDGTCIMTFRQHFDYVTCLAAAENKMKTIA 59 + WNCLSDGTC T RQH DYVTCLAAAE +A Sbjct: 107 KTWNCLSDGTCTRTLRQHSDYVTCLAAAEKNSNVVA 142 Score = 43.9 bits (102), Expect(2) = 2e-13 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -1 Query: 71 ENNSKIVTSGGLGGEVFIWDLEA 3 E NS +V SGGLGGEVF+WDLEA Sbjct: 135 EKNSNVVASGGLGGEVFVWDLEA 157 >ref|XP_011032511.1| PREDICTED: WD repeat-containing protein 48-like [Populus euphratica] Length = 761 Score = 57.4 bits (137), Expect(2) = 4e-13 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -2 Query: 166 EAWNCLSDGTCIMTFRQHFDYVTCLAAAENKMKTIA 59 + WNCLSDGTC T RQH DYVTCLAAAE +A Sbjct: 108 KTWNCLSDGTCTKTLRQHSDYVTCLAAAEKNSNIVA 143 Score = 43.5 bits (101), Expect(2) = 4e-13 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -1 Query: 71 ENNSKIVTSGGLGGEVFIWDLEA 3 E NS IV SGGLGGEVFIWD+EA Sbjct: 136 EKNSNIVASGGLGGEVFIWDVEA 158 >ref|XP_006382725.1| hypothetical protein POPTR_0005s04800g [Populus trichocarpa] gi|550338092|gb|ERP60522.1| hypothetical protein POPTR_0005s04800g [Populus trichocarpa] Length = 761 Score = 57.4 bits (137), Expect(2) = 4e-13 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -2 Query: 166 EAWNCLSDGTCIMTFRQHFDYVTCLAAAENKMKTIA 59 + WNCLSDGTC T RQH DYVTCLAAAE +A Sbjct: 108 KTWNCLSDGTCTKTLRQHSDYVTCLAAAEKNSNIVA 143 Score = 43.5 bits (101), Expect(2) = 4e-13 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -1 Query: 71 ENNSKIVTSGGLGGEVFIWDLEA 3 E NS IV SGGLGGEVFIWD+EA Sbjct: 136 EKNSNIVASGGLGGEVFIWDVEA 158 >ref|XP_012492919.1| PREDICTED: WD repeat-containing protein 48 isoform X1 [Gossypium raimondii] gi|763777918|gb|KJB45041.1| hypothetical protein B456_007G286900 [Gossypium raimondii] Length = 763 Score = 58.5 bits (140), Expect(2) = 5e-13 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = -2 Query: 166 EAWNCLSDGTCIMTFRQHFDYVTCLAAAENKMKTIA 59 + WNCLS+GTC TFRQH DYVTCLAAAE +A Sbjct: 108 KTWNCLSEGTCTRTFRQHSDYVTCLAAAEKNTNVVA 143 Score = 42.0 bits (97), Expect(2) = 5e-13 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = -1 Query: 71 ENNSKIVTSGGLGGEVFIWDLEA 3 E N+ +V SGGLGGEVF+WD+EA Sbjct: 136 EKNTNVVASGGLGGEVFVWDIEA 158 >ref|XP_012492920.1| PREDICTED: WD repeat-containing protein 48 homolog isoform X2 [Gossypium raimondii] Length = 703 Score = 58.5 bits (140), Expect(2) = 5e-13 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = -2 Query: 166 EAWNCLSDGTCIMTFRQHFDYVTCLAAAENKMKTIA 59 + WNCLS+GTC TFRQH DYVTCLAAAE +A Sbjct: 108 KTWNCLSEGTCTRTFRQHSDYVTCLAAAEKNTNVVA 143 Score = 42.0 bits (97), Expect(2) = 5e-13 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = -1 Query: 71 ENNSKIVTSGGLGGEVFIWDLEA 3 E N+ +V SGGLGGEVF+WD+EA Sbjct: 136 EKNTNVVASGGLGGEVFVWDIEA 158 >gb|KJB45042.1| hypothetical protein B456_007G286900 [Gossypium raimondii] Length = 691 Score = 58.5 bits (140), Expect(2) = 5e-13 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = -2 Query: 166 EAWNCLSDGTCIMTFRQHFDYVTCLAAAENKMKTIA 59 + WNCLS+GTC TFRQH DYVTCLAAAE +A Sbjct: 108 KTWNCLSEGTCTRTFRQHSDYVTCLAAAEKNTNVVA 143 Score = 42.0 bits (97), Expect(2) = 5e-13 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = -1 Query: 71 ENNSKIVTSGGLGGEVFIWDLEA 3 E N+ +V SGGLGGEVF+WD+EA Sbjct: 136 EKNTNVVASGGLGGEVFVWDIEA 158 >ref|XP_011003807.1| PREDICTED: WD repeat-containing protein 48-like [Populus euphratica] gi|743919567|ref|XP_011003808.1| PREDICTED: WD repeat-containing protein 48-like [Populus euphratica] gi|743919569|ref|XP_011003810.1| PREDICTED: WD repeat-containing protein 48-like [Populus euphratica] gi|743919571|ref|XP_011003811.1| PREDICTED: WD repeat-containing protein 48-like [Populus euphratica] gi|743919573|ref|XP_011003812.1| PREDICTED: WD repeat-containing protein 48-like [Populus euphratica] gi|743919575|ref|XP_011003813.1| PREDICTED: WD repeat-containing protein 48-like [Populus euphratica] Length = 760 Score = 56.6 bits (135), Expect(2) = 6e-13 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -2 Query: 166 EAWNCLSDGTCIMTFRQHFDYVTCLAAAENKMKTIA 59 +AWNCLSDGTC T RQH DYV CLAAAE +A Sbjct: 108 KAWNCLSDGTCTKTLRQHSDYVICLAAAEKNSNIVA 143 Score = 43.5 bits (101), Expect(2) = 6e-13 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -1 Query: 71 ENNSKIVTSGGLGGEVFIWDLEA 3 E NS IV SGGLGGEVFIWD+EA Sbjct: 136 EKNSNIVASGGLGGEVFIWDVEA 158 >ref|XP_006389300.1| hypothetical protein POPTR_0030s00210g [Populus trichocarpa] gi|550312060|gb|ERP48214.1| hypothetical protein POPTR_0030s00210g [Populus trichocarpa] Length = 745 Score = 57.0 bits (136), Expect(2) = 6e-13 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -2 Query: 166 EAWNCLSDGTCIMTFRQHFDYVTCLAAAENKMKTIA 59 +AWNCLSDGTC T RQH DYV CLAAAE +A Sbjct: 108 KAWNCLSDGTCTKTLRQHSDYVICLAAAEKNSNVVA 143 Score = 43.1 bits (100), Expect(2) = 6e-13 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -1 Query: 71 ENNSKIVTSGGLGGEVFIWDLEA 3 E NS +V SGGLGGEVFIWD+EA Sbjct: 136 EKNSNVVASGGLGGEVFIWDVEA 158 >ref|XP_006389301.1| hypothetical protein POPTR_0030s00210g [Populus trichocarpa] gi|550312061|gb|ERP48215.1| hypothetical protein POPTR_0030s00210g [Populus trichocarpa] Length = 689 Score = 57.0 bits (136), Expect(2) = 6e-13 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -2 Query: 166 EAWNCLSDGTCIMTFRQHFDYVTCLAAAENKMKTIA 59 +AWNCLSDGTC T RQH DYV CLAAAE +A Sbjct: 108 KAWNCLSDGTCTKTLRQHSDYVICLAAAEKNSNVVA 143 Score = 43.1 bits (100), Expect(2) = 6e-13 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -1 Query: 71 ENNSKIVTSGGLGGEVFIWDLEA 3 E NS +V SGGLGGEVFIWD+EA Sbjct: 136 EKNSNVVASGGLGGEVFIWDVEA 158 >ref|XP_007030678.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|590642996|ref|XP_007030679.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|590643000|ref|XP_007030680.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508719283|gb|EOY11180.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508719284|gb|EOY11181.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508719285|gb|EOY11182.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma cacao] Length = 763 Score = 57.8 bits (138), Expect(2) = 8e-13 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -2 Query: 166 EAWNCLSDGTCIMTFRQHFDYVTCLAAAENKMKTIA 59 + WNCLSDGTC T RQH DYVTCLAAAE +A Sbjct: 108 KTWNCLSDGTCTRTLRQHSDYVTCLAAAEKNTNVVA 143 Score = 42.0 bits (97), Expect(2) = 8e-13 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = -1 Query: 71 ENNSKIVTSGGLGGEVFIWDLEA 3 E N+ +V SGGLGGEVF+WD+EA Sbjct: 136 EKNTNVVASGGLGGEVFVWDIEA 158 >ref|XP_012463752.1| PREDICTED: WD repeat-containing protein 48-like isoform X1 [Gossypium raimondii] gi|823262032|ref|XP_012463753.1| PREDICTED: WD repeat-containing protein 48-like isoform X1 [Gossypium raimondii] gi|823262034|ref|XP_012463755.1| PREDICTED: WD repeat-containing protein 48-like isoform X1 [Gossypium raimondii] gi|823262036|ref|XP_012463756.1| PREDICTED: WD repeat-containing protein 48-like isoform X1 [Gossypium raimondii] gi|763814080|gb|KJB80932.1| hypothetical protein B456_013G122600 [Gossypium raimondii] gi|763814081|gb|KJB80933.1| hypothetical protein B456_013G122600 [Gossypium raimondii] Length = 761 Score = 57.8 bits (138), Expect(2) = 8e-13 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -2 Query: 166 EAWNCLSDGTCIMTFRQHFDYVTCLAAAENKMKTIA 59 + WNCLSDGTC T RQH DYVTCLAAAE +A Sbjct: 108 KTWNCLSDGTCTSTLRQHSDYVTCLAAAEKNTNVVA 143 Score = 42.0 bits (97), Expect(2) = 8e-13 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = -1 Query: 71 ENNSKIVTSGGLGGEVFIWDLEA 3 E N+ +V SGGLGGEVF+WD+EA Sbjct: 136 EKNTNVVASGGLGGEVFVWDIEA 158 >ref|XP_010905113.1| PREDICTED: WD repeat-containing protein 48-like isoform X1 [Elaeis guineensis] gi|743866663|ref|XP_010905114.1| PREDICTED: WD repeat-containing protein 48-like isoform X1 [Elaeis guineensis] Length = 760 Score = 55.8 bits (133), Expect(2) = 8e-13 Identities = 23/36 (63%), Positives = 26/36 (72%) Frame = -2 Query: 166 EAWNCLSDGTCIMTFRQHFDYVTCLAAAENKMKTIA 59 + WNCLSDGTC+ T RQH DYV CLAAAE +A Sbjct: 107 KTWNCLSDGTCMRTLRQHSDYVICLAAAEKNSNIVA 142 Score = 43.9 bits (102), Expect(2) = 8e-13 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -1 Query: 71 ENNSKIVTSGGLGGEVFIWDLEA 3 E NS IV SGGLGGEVFIWD+EA Sbjct: 135 EKNSNIVASGGLGGEVFIWDIEA 157 >ref|XP_012463757.1| PREDICTED: WD repeat-containing protein 48-like isoform X2 [Gossypium raimondii] Length = 748 Score = 57.8 bits (138), Expect(2) = 8e-13 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -2 Query: 166 EAWNCLSDGTCIMTFRQHFDYVTCLAAAENKMKTIA 59 + WNCLSDGTC T RQH DYVTCLAAAE +A Sbjct: 108 KTWNCLSDGTCTSTLRQHSDYVTCLAAAEKNTNVVA 143 Score = 42.0 bits (97), Expect(2) = 8e-13 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = -1 Query: 71 ENNSKIVTSGGLGGEVFIWDLEA 3 E N+ +V SGGLGGEVF+WD+EA Sbjct: 136 EKNTNVVASGGLGGEVFVWDIEA 158