BLASTX nr result
ID: Forsythia22_contig00023340
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00023340 (280 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP02801.1| unnamed protein product [Coffea canephora] 59 1e-06 >emb|CDP02801.1| unnamed protein product [Coffea canephora] Length = 386 Score = 59.3 bits (142), Expect = 1e-06 Identities = 32/51 (62%), Positives = 36/51 (70%), Gaps = 1/51 (1%) Frame = -3 Query: 164 MSLVNPIATWYQTNSM-NNLPSSRYRSGQVFSFLHHPLKNKLPISFFSPKP 15 MSLVN ATW QT S+ NNL SSR+ S S+L+HPLKNKLP S F P P Sbjct: 1 MSLVNSSATWVQTPSIYNNLTSSRHNSAN--SYLYHPLKNKLPFSIFLPNP 49