BLASTX nr result
ID: Forsythia22_contig00023090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00023090 (488 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007042387.1| Presequence protease 2 isoform 4 [Theobroma ... 57 5e-06 gb|EMS56412.1| Presequence protease 1, chloroplastic/mitochondri... 57 5e-06 >ref|XP_007042387.1| Presequence protease 2 isoform 4 [Theobroma cacao] gi|508706322|gb|EOX98218.1| Presequence protease 2 isoform 4 [Theobroma cacao] Length = 849 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +2 Query: 2 GHGIAAARMDAKLNVAGWISEKMGGVRLNY 91 GHGIAAARMDAKLNV+GWISE+MGGVR+ + Sbjct: 786 GHGIAAARMDAKLNVSGWISEQMGGVRVTW 815 >gb|EMS56412.1| Presequence protease 1, chloroplastic/mitochondrial [Triticum urartu] Length = 974 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +2 Query: 2 GHGIAAARMDAKLNVAGWISEKMGGVRL 85 GHGIAAARMDAKLN AGWISE+MGGVRL Sbjct: 662 GHGIAAARMDAKLNAAGWISEQMGGVRL 689