BLASTX nr result
ID: Forsythia22_contig00023089
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00023089 (292 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075350.1| PREDICTED: calcium-transporting ATPase 4, pl... 59 1e-06 >ref|XP_011075350.1| PREDICTED: calcium-transporting ATPase 4, plasma membrane-type-like [Sesamum indicum] Length = 1055 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -3 Query: 116 MENFISKDFDLPHKNRSEENLLRWRNAVGKIVKNRRRR 3 ME FI +FDLP K RSEE L RWR+AVGK+VKNRRRR Sbjct: 1 MEKFIPPEFDLPLKGRSEEALKRWRDAVGKLVKNRRRR 38