BLASTX nr result
ID: Forsythia22_contig00023043
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00023043 (395 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086090.1| PREDICTED: uncharacterized protein LOC105167... 60 4e-07 gb|EYU43404.1| hypothetical protein MIMGU_mgv1a016915mg [Erythra... 56 8e-06 >ref|XP_011086090.1| PREDICTED: uncharacterized protein LOC105167914 [Sesamum indicum] Length = 148 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -2 Query: 394 NAREVSVLMPGDNVPTFIAQPAPVPFPTEGMPSPS 290 NAREVSV+MPGDNVPTFIA PAPVPFP E + PS Sbjct: 100 NAREVSVVMPGDNVPTFIAHPAPVPFPPERLRWPS 134 >gb|EYU43404.1| hypothetical protein MIMGU_mgv1a016915mg [Erythranthe guttata] Length = 101 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 394 NAREVSVLMPGDNVPTFIAQPAPVPFPTEGM 302 NAREVSV+MPGDNVPTFIA PAPVP P E M Sbjct: 63 NAREVSVVMPGDNVPTFIAHPAPVPCPPERM 93