BLASTX nr result
ID: Forsythia22_contig00022646
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00022646 (499 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010025181.1| PREDICTED: phosphoenolpyruvate/phosphate tra... 57 5e-06 ref|XP_002282424.1| PREDICTED: phosphoenolpyruvate/phosphate tra... 56 8e-06 >ref|XP_010025181.1| PREDICTED: phosphoenolpyruvate/phosphate translocator 2, chloroplastic-like [Eucalyptus grandis] Length = 287 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -1 Query: 349 ALLFEQFPTIWVVSSLLPFVDGLALASTTEASFNW 245 A+ +FPTIWVVSSLLP V G+ALAS TEASFNW Sbjct: 148 AMFLGEFPTIWVVSSLLPIVGGVALASMTEASFNW 182 >ref|XP_002282424.1| PREDICTED: phosphoenolpyruvate/phosphate translocator 1, chloroplastic [Vitis vinifera] gi|297733768|emb|CBI15015.3| unnamed protein product [Vitis vinifera] Length = 410 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -1 Query: 349 ALLFEQFPTIWVVSSLLPFVDGLALASTTEASFNW 245 A+ +FPTIWV+SSLLP V G+ALAS TEASFNW Sbjct: 219 AMFLGEFPTIWVLSSLLPIVGGVALASATEASFNW 253