BLASTX nr result
ID: Forsythia22_contig00022643
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00022643 (224 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012856679.1| PREDICTED: uncharacterized protein LOC105975... 61 3e-07 >ref|XP_012856679.1| PREDICTED: uncharacterized protein LOC105975962 [Erythranthe guttatus] gi|848919101|ref|XP_012856680.1| PREDICTED: uncharacterized protein LOC105975962 [Erythranthe guttatus] gi|604301871|gb|EYU21457.1| hypothetical protein MIMGU_mgv1a005411mg [Erythranthe guttata] Length = 484 Score = 61.2 bits (147), Expect = 3e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -1 Query: 224 AISLGWVGISNIIGKVEGKEYIWFYNICEY 135 AISLGWVGISNIIG+VEG+EY+WFY+IC+Y Sbjct: 452 AISLGWVGISNIIGEVEGQEYMWFYDICKY 481