BLASTX nr result
ID: Forsythia22_contig00022630
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00022630 (217 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010942597.1| PREDICTED: uncharacterized protein LOC105060... 74 5e-11 ref|XP_009624026.1| PREDICTED: RPM1-interacting protein 4-like i... 72 1e-10 gb|KJB13906.1| hypothetical protein B456_002G101100 [Gossypium r... 70 4e-10 gb|KJB13905.1| hypothetical protein B456_002G101100 [Gossypium r... 70 4e-10 gb|KHG00197.1| RPM1-interacting 4 -like protein [Gossypium arbor... 70 4e-10 ref|XP_010324248.1| PREDICTED: RPM1-interacting protein 4 isofor... 70 4e-10 ref|XP_009408747.1| PREDICTED: uncharacterized protein LOC103991... 70 4e-10 gb|ADE76265.1| unknown [Picea sitchensis] 70 4e-10 ref|XP_006346127.1| PREDICTED: RPM1-interacting protein 4-like i... 70 4e-10 ref|XP_007207400.1| hypothetical protein PRUPE_ppa014254mg [Prun... 70 4e-10 ref|XP_010942598.1| PREDICTED: uncharacterized protein LOC105060... 70 5e-10 ref|XP_012081506.1| PREDICTED: RPM1-interacting protein 4 [Jatro... 70 7e-10 ref|XP_010551964.1| PREDICTED: RPM1-interacting protein 4-like [... 70 7e-10 ref|XP_010061443.1| PREDICTED: RPM1-interacting protein 4-like i... 70 7e-10 ref|XP_010061442.1| PREDICTED: RPM1-interacting protein 4-like i... 70 7e-10 ref|XP_010061441.1| PREDICTED: RPM1-interacting protein 4-like i... 70 7e-10 ref|XP_009624027.1| PREDICTED: RPM1-interacting protein 4-like i... 70 7e-10 ref|XP_009408263.1| PREDICTED: RPM1-interacting protein 4-like [... 70 7e-10 gb|KDP29951.1| hypothetical protein JCGZ_18520 [Jatropha curcas] 70 7e-10 ref|XP_010063254.1| PREDICTED: RPM1-interacting protein 4-like [... 70 7e-10 >ref|XP_010942597.1| PREDICTED: uncharacterized protein LOC105060536 isoform X1 [Elaeis guineensis] Length = 128 Score = 73.6 bits (179), Expect = 5e-11 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -2 Query: 114 MHTFVSKEKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 1 + F+S++KGQPLPKFGEWDVNDPASAEGFTVIFNKAR Sbjct: 42 LEEFMSQDKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 79 >ref|XP_009624026.1| PREDICTED: RPM1-interacting protein 4-like isoform X1 [Nicotiana tomentosiformis] Length = 78 Score = 72.0 bits (175), Expect = 1e-10 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -2 Query: 102 VSKEKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 1 +S+EKGQPLPKFGEWDVNDPASAEGFTVIFNKAR Sbjct: 1 MSQEKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 34 >gb|KJB13906.1| hypothetical protein B456_002G101100 [Gossypium raimondii] Length = 88 Score = 70.5 bits (171), Expect = 4e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 102 VSKEKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 1 +S+EKG+PLPKFGEWDVNDPASAEGFTVIFNKAR Sbjct: 1 MSEEKGRPLPKFGEWDVNDPASAEGFTVIFNKAR 34 >gb|KJB13905.1| hypothetical protein B456_002G101100 [Gossypium raimondii] Length = 78 Score = 70.5 bits (171), Expect = 4e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 102 VSKEKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 1 +S+EKG+PLPKFGEWDVNDPASAEGFTVIFNKAR Sbjct: 1 MSEEKGRPLPKFGEWDVNDPASAEGFTVIFNKAR 34 >gb|KHG00197.1| RPM1-interacting 4 -like protein [Gossypium arboreum] Length = 78 Score = 70.5 bits (171), Expect = 4e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 102 VSKEKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 1 +S+EKG+PLPKFGEWDVNDPASAEGFTVIFNKAR Sbjct: 1 MSEEKGRPLPKFGEWDVNDPASAEGFTVIFNKAR 34 >ref|XP_010324248.1| PREDICTED: RPM1-interacting protein 4 isoform X1 [Solanum lycopersicum] Length = 78 Score = 70.5 bits (171), Expect = 4e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 102 VSKEKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 1 +S+EKG+PLPKFGEWDVNDPASAEGFTVIFNKAR Sbjct: 1 MSQEKGRPLPKFGEWDVNDPASAEGFTVIFNKAR 34 >ref|XP_009408747.1| PREDICTED: uncharacterized protein LOC103991115 [Musa acuminata subsp. malaccensis] Length = 151 Score = 70.5 bits (171), Expect = 4e-10 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -2 Query: 120 R*MHTFVSKEKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 1 R + + +S EKGQPLPKFGEWDVN+PASAEGFTVIFNKAR Sbjct: 70 RPISSIMSSEKGQPLPKFGEWDVNNPASAEGFTVIFNKAR 109 >gb|ADE76265.1| unknown [Picea sitchensis] Length = 86 Score = 70.5 bits (171), Expect = 4e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 102 VSKEKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 1 +S+EKG+PLPKFGEWDVNDPASAEGFTVIFNKAR Sbjct: 1 MSQEKGRPLPKFGEWDVNDPASAEGFTVIFNKAR 34 >ref|XP_006346127.1| PREDICTED: RPM1-interacting protein 4-like isoform X1 [Solanum tuberosum] Length = 78 Score = 70.5 bits (171), Expect = 4e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 102 VSKEKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 1 +S+EKG+PLPKFGEWDVNDPASAEGFTVIFNKAR Sbjct: 1 MSQEKGRPLPKFGEWDVNDPASAEGFTVIFNKAR 34 >ref|XP_007207400.1| hypothetical protein PRUPE_ppa014254mg [Prunus persica] gi|462403042|gb|EMJ08599.1| hypothetical protein PRUPE_ppa014254mg [Prunus persica] Length = 78 Score = 70.5 bits (171), Expect = 4e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 102 VSKEKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 1 +S+EKG+PLPKFGEWDVNDPASAEGFTVIFNKAR Sbjct: 1 MSQEKGRPLPKFGEWDVNDPASAEGFTVIFNKAR 34 >ref|XP_010942598.1| PREDICTED: uncharacterized protein LOC105060536 isoform X2 [Elaeis guineensis] Length = 99 Score = 70.1 bits (170), Expect = 5e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -2 Query: 102 VSKEKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 1 + ++KGQPLPKFGEWDVNDPASAEGFTVIFNKAR Sbjct: 16 IKQDKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 49 >ref|XP_012081506.1| PREDICTED: RPM1-interacting protein 4 [Jatropha curcas] Length = 77 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 93 EKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 1 EKGQPLPKFGEWDVNDPASAEGFTVIFNKAR Sbjct: 3 EKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 33 >ref|XP_010551964.1| PREDICTED: RPM1-interacting protein 4-like [Tarenaya hassleriana] Length = 77 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 93 EKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 1 EKGQPLPKFGEWDVNDPASAEGFTVIFNKAR Sbjct: 3 EKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 33 >ref|XP_010061443.1| PREDICTED: RPM1-interacting protein 4-like isoform X3 [Eucalyptus grandis] Length = 76 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 93 EKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 1 EKGQPLPKFGEWDVNDPASAEGFTVIFNKAR Sbjct: 2 EKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 32 >ref|XP_010061442.1| PREDICTED: RPM1-interacting protein 4-like isoform X2 [Eucalyptus grandis] Length = 77 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 93 EKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 1 EKGQPLPKFGEWDVNDPASAEGFTVIFNKAR Sbjct: 3 EKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 33 >ref|XP_010061441.1| PREDICTED: RPM1-interacting protein 4-like isoform X1 [Eucalyptus grandis] Length = 113 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 93 EKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 1 EKGQPLPKFGEWDVNDPASAEGFTVIFNKAR Sbjct: 39 EKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 69 >ref|XP_009624027.1| PREDICTED: RPM1-interacting protein 4-like isoform X2 [Nicotiana tomentosiformis] Length = 77 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 93 EKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 1 EKGQPLPKFGEWDVNDPASAEGFTVIFNKAR Sbjct: 3 EKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 33 >ref|XP_009408263.1| PREDICTED: RPM1-interacting protein 4-like [Musa acuminata subsp. malaccensis] Length = 76 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 102 VSKEKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 1 +S EKGQPLPKFGEWDVN+PASAEGFTVIFNKAR Sbjct: 1 MSSEKGQPLPKFGEWDVNNPASAEGFTVIFNKAR 34 >gb|KDP29951.1| hypothetical protein JCGZ_18520 [Jatropha curcas] Length = 80 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 93 EKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 1 EKGQPLPKFGEWDVNDPASAEGFTVIFNKAR Sbjct: 3 EKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 33 >ref|XP_010063254.1| PREDICTED: RPM1-interacting protein 4-like [Eucalyptus grandis] gi|629104998|gb|KCW70467.1| hypothetical protein EUGRSUZ_F03683 [Eucalyptus grandis] Length = 76 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 93 EKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 1 EKGQPLPKFGEWDVNDPASAEGFTVIFNKAR Sbjct: 3 EKGQPLPKFGEWDVNDPASAEGFTVIFNKAR 33