BLASTX nr result
ID: Forsythia22_contig00022585
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00022585 (324 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009023726.1| hypothetical protein HELRODRAFT_84957, parti... 59 1e-06 ref|XP_001634132.1| predicted protein [Nematostella vectensis] g... 58 2e-06 >ref|XP_009023726.1| hypothetical protein HELRODRAFT_84957, partial [Helobdella robusta] gi|555694837|gb|ESN98069.1| hypothetical protein HELRODRAFT_84957, partial [Helobdella robusta] Length = 1025 Score = 59.3 bits (142), Expect = 1e-06 Identities = 33/113 (29%), Positives = 48/113 (42%), Gaps = 9/113 (7%) Frame = -3 Query: 316 QGLRLHQLHMVRRHYQWFHPRHHLENQVTLYQQQIQGLRLHQLHMVRRHYQSFHPR---- 149 QG H + HY H RHH + Y+ + + HQ H R+HY H R Sbjct: 205 QGYHYHHHYRHHHHYYHHHYRHHYRHHYHNYRLRYRNCYRHQQHHYRQHYHRHHHRCHRH 264 Query: 148 ----HHLDNHVTLYQQQIQGLRLHQLHMVRR-HYQWFHPRHHLDNHVTLYQQQ 5 HH +H L+ ++ RLH H R H++ H HH H L+ ++ Sbjct: 265 HHRLHHHHHHHRLHHHRLHHRRLHHHHHHHRLHHRRLHHHHHRRRHHRLHHRR 317 >ref|XP_001634132.1| predicted protein [Nematostella vectensis] gi|156221211|gb|EDO42069.1| predicted protein, partial [Nematostella vectensis] Length = 173 Score = 58.2 bits (139), Expect = 2e-06 Identities = 38/104 (36%), Positives = 57/104 (54%), Gaps = 3/104 (2%) Frame = -3 Query: 316 QGLRLH-QLHMVRRHYQWFHPRHHLENQVTLYQQQIQGLRLH-QLHMVRRHYQSFHPRHH 143 Q LR H Q+ ++R HYQ R+H + +V Y Q++ LR H Q+ ++R HYQ RHH Sbjct: 68 QILRYHYQVKILRYHYQVKILRYHYQVKVLRYHYQVKILRYHYQVKILRYHYQVKILRHH 127 Query: 142 LDNHVTLYQQQIQGLRLH-QLHMVRRHYQWFHPRHHLDNHVTLY 14 + Y Q++ LR H Q+ ++R HYQ R+H + Y Sbjct: 128 YQVKILRYHYQVKILRYHYQVKILRYHYQVKILRYHYQVKILTY 171