BLASTX nr result
ID: Forsythia22_contig00022473
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00022473 (249 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI34533.3| unnamed protein product [Vitis vinifera] 74 4e-11 ref|XP_002264340.1| PREDICTED: 30S ribosomal protein S6 alpha, c... 74 4e-11 ref|XP_011082733.1| PREDICTED: 30S ribosomal protein S6 alpha, c... 74 5e-11 emb|CDP12186.1| unnamed protein product [Coffea canephora] 72 1e-10 ref|XP_012848038.1| PREDICTED: 30S ribosomal protein S6 alpha, c... 71 3e-10 ref|XP_002518855.1| structural constituent of ribosome, putative... 70 5e-10 ref|XP_012848028.1| PREDICTED: 30S ribosomal protein S6 alpha, c... 70 7e-10 ref|XP_002297965.2| hypothetical protein POPTR_0001s10930g [Popu... 70 7e-10 ref|XP_010924910.1| PREDICTED: 30S ribosomal protein S6 alpha, c... 69 9e-10 ref|XP_006476347.1| PREDICTED: 30S ribosomal protein S6 alpha, c... 69 9e-10 ref|XP_006439300.1| hypothetical protein CICLE_v10022161mg [Citr... 69 9e-10 ref|XP_009779031.1| PREDICTED: 30S ribosomal protein S6 alpha, c... 69 1e-09 ref|XP_009613808.1| PREDICTED: 30S ribosomal protein S6 alpha, c... 69 1e-09 ref|XP_008806412.1| PREDICTED: 30S ribosomal protein S6 alpha, c... 69 1e-09 ref|XP_011026846.1| PREDICTED: 30S ribosomal protein S6 alpha, c... 69 2e-09 ref|XP_010053167.1| PREDICTED: 30S ribosomal protein S6 alpha, c... 69 2e-09 gb|KCW77424.1| hypothetical protein EUGRSUZ_D01771, partial [Euc... 69 2e-09 ref|XP_009358639.1| PREDICTED: 30S ribosomal protein S6 alpha, c... 68 2e-09 ref|XP_011654693.1| PREDICTED: 30S ribosomal protein S6 alpha, c... 68 3e-09 ref|XP_008337563.1| PREDICTED: 30S ribosomal protein S6 alpha, c... 68 3e-09 >emb|CBI34533.3| unnamed protein product [Vitis vinifera] Length = 101 Score = 73.9 bits (180), Expect = 4e-11 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -1 Query: 249 GIYLLFTYFTKPESMEILAETLQADDDVIRSSSFKIRKRK 130 GIYLLFTYFTKPESME+L TL ADDDVIRSSSFKIRKRK Sbjct: 61 GIYLLFTYFTKPESMEVLEATLTADDDVIRSSSFKIRKRK 100 >ref|XP_002264340.1| PREDICTED: 30S ribosomal protein S6 alpha, chloroplastic [Vitis vinifera] Length = 199 Score = 73.9 bits (180), Expect = 4e-11 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -1 Query: 249 GIYLLFTYFTKPESMEILAETLQADDDVIRSSSFKIRKRK 130 GIYLLFTYFTKPESME+L TL ADDDVIRSSSFKIRKRK Sbjct: 159 GIYLLFTYFTKPESMEVLEATLTADDDVIRSSSFKIRKRK 198 >ref|XP_011082733.1| PREDICTED: 30S ribosomal protein S6 alpha, chloroplastic [Sesamum indicum] Length = 206 Score = 73.6 bits (179), Expect = 5e-11 Identities = 37/40 (92%), Positives = 37/40 (92%) Frame = -1 Query: 249 GIYLLFTYFTKPESMEILAETLQADDDVIRSSSFKIRKRK 130 GIYLLFTYFTKPESM IL ETL ADDDVIRSSSFKIRKRK Sbjct: 166 GIYLLFTYFTKPESMTILNETLLADDDVIRSSSFKIRKRK 205 >emb|CDP12186.1| unnamed protein product [Coffea canephora] Length = 199 Score = 72.0 bits (175), Expect = 1e-10 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -1 Query: 249 GIYLLFTYFTKPESMEILAETLQADDDVIRSSSFKIRKRK 130 GIYLLFTYFTKPESME+L T++ADDDVIRS SFK+RKRK Sbjct: 159 GIYLLFTYFTKPESMEVLESTMKADDDVIRSMSFKVRKRK 198 >ref|XP_012848038.1| PREDICTED: 30S ribosomal protein S6 alpha, chloroplastic-like [Erythranthe guttatus] gi|604346555|gb|EYU44999.1| hypothetical protein MIMGU_mgv1a013841mg [Erythranthe guttata] Length = 209 Score = 70.9 bits (172), Expect = 3e-10 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = -1 Query: 249 GIYLLFTYFTKPESMEILAETLQADDDVIRSSSFKIRKRKLF 124 GIYLLFTYFTKP+S+ +L +TL ADD+VIRSS+FKIRKRKLF Sbjct: 168 GIYLLFTYFTKPDSITVLEDTLLADDEVIRSSTFKIRKRKLF 209 >ref|XP_002518855.1| structural constituent of ribosome, putative [Ricinus communis] gi|223541842|gb|EEF43388.1| structural constituent of ribosome, putative [Ricinus communis] Length = 205 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -1 Query: 249 GIYLLFTYFTKPESMEILAETLQADDDVIRSSSFKIRKRK 130 GIYLLFTYFTKPES+E+L TL DDD+IRSSSFKIRKRK Sbjct: 165 GIYLLFTYFTKPESIEMLEATLNTDDDIIRSSSFKIRKRK 204 >ref|XP_012848028.1| PREDICTED: 30S ribosomal protein S6 alpha, chloroplastic-like [Erythranthe guttatus] Length = 221 Score = 69.7 bits (169), Expect = 7e-10 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -1 Query: 249 GIYLLFTYFTKPESMEILAETLQADDDVIRSSSFKIRKRKL 127 GIYLLFTYFTKP+S+ +L ETL ADD+VIRSS+FKIRKRKL Sbjct: 163 GIYLLFTYFTKPDSITVLEETLLADDEVIRSSTFKIRKRKL 203 >ref|XP_002297965.2| hypothetical protein POPTR_0001s10930g [Populus trichocarpa] gi|550346990|gb|EEE82770.2| hypothetical protein POPTR_0001s10930g [Populus trichocarpa] Length = 240 Score = 69.7 bits (169), Expect = 7e-10 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -1 Query: 249 GIYLLFTYFTKPESMEILAETLQADDDVIRSSSFKIRKRK 130 GIYLLFTYFTKPES+ IL +TL DDDVIRSSSFK+RKRK Sbjct: 200 GIYLLFTYFTKPESIGILEQTLNTDDDVIRSSSFKVRKRK 239 >ref|XP_010924910.1| PREDICTED: 30S ribosomal protein S6 alpha, chloroplastic isoform X1 [Elaeis guineensis] Length = 204 Score = 69.3 bits (168), Expect = 9e-10 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -1 Query: 249 GIYLLFTYFTKPESMEILAETLQADDDVIRSSSFKIRKRK 130 GIYLLFTYFTKPESM +L L+ADDDVIRSS+FKIRKRK Sbjct: 164 GIYLLFTYFTKPESMAVLESRLKADDDVIRSSTFKIRKRK 203 >ref|XP_006476347.1| PREDICTED: 30S ribosomal protein S6 alpha, chloroplastic-like [Citrus sinensis] gi|641857859|gb|KDO76604.1| hypothetical protein CISIN_1g027743mg [Citrus sinensis] Length = 219 Score = 69.3 bits (168), Expect = 9e-10 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -1 Query: 249 GIYLLFTYFTKPESMEILAETLQADDDVIRSSSFKIRKRK 130 GIYLLFTYFTKPES+E L T++ADDDVIRSSSFK+RK+K Sbjct: 177 GIYLLFTYFTKPESIEALERTMKADDDVIRSSSFKVRKQK 216 >ref|XP_006439300.1| hypothetical protein CICLE_v10022161mg [Citrus clementina] gi|557541562|gb|ESR52540.1| hypothetical protein CICLE_v10022161mg [Citrus clementina] Length = 219 Score = 69.3 bits (168), Expect = 9e-10 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -1 Query: 249 GIYLLFTYFTKPESMEILAETLQADDDVIRSSSFKIRKRK 130 GIYLLFTYFTKPES+E L T++ADDDVIRSSSFK+RK+K Sbjct: 177 GIYLLFTYFTKPESIEALERTMKADDDVIRSSSFKVRKQK 216 >ref|XP_009779031.1| PREDICTED: 30S ribosomal protein S6 alpha, chloroplastic-like [Nicotiana sylvestris] Length = 196 Score = 68.9 bits (167), Expect = 1e-09 Identities = 34/40 (85%), Positives = 34/40 (85%) Frame = -1 Query: 249 GIYLLFTYFTKPESMEILAETLQADDDVIRSSSFKIRKRK 130 GIYLLFTYFTKPESM L TL DDDVIRSSSFKIRKRK Sbjct: 156 GIYLLFTYFTKPESMTALEATLNTDDDVIRSSSFKIRKRK 195 >ref|XP_009613808.1| PREDICTED: 30S ribosomal protein S6 alpha, chloroplastic-like [Nicotiana tomentosiformis] Length = 199 Score = 68.9 bits (167), Expect = 1e-09 Identities = 34/40 (85%), Positives = 34/40 (85%) Frame = -1 Query: 249 GIYLLFTYFTKPESMEILAETLQADDDVIRSSSFKIRKRK 130 GIYLLFTYFTKPESM L TL DDDVIRSSSFKIRKRK Sbjct: 159 GIYLLFTYFTKPESMTALEATLNTDDDVIRSSSFKIRKRK 198 >ref|XP_008806412.1| PREDICTED: 30S ribosomal protein S6 alpha, chloroplastic [Phoenix dactylifera] Length = 206 Score = 68.9 bits (167), Expect = 1e-09 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -1 Query: 249 GIYLLFTYFTKPESMEILAETLQADDDVIRSSSFKIRKRKL 127 GIYLLFTYFTKPESM L L ADDDVIRSS+FKIRKRKL Sbjct: 166 GIYLLFTYFTKPESMAALESRLNADDDVIRSSTFKIRKRKL 206 >ref|XP_011026846.1| PREDICTED: 30S ribosomal protein S6 alpha, chloroplastic [Populus euphratica] Length = 240 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -1 Query: 249 GIYLLFTYFTKPESMEILAETLQADDDVIRSSSFKIRKRK 130 GIYLLFTYFTKPES+ IL +TL DDDVIRSS+FK+RKRK Sbjct: 200 GIYLLFTYFTKPESIGILEQTLNTDDDVIRSSTFKVRKRK 239 >ref|XP_010053167.1| PREDICTED: 30S ribosomal protein S6 alpha, chloroplastic [Eucalyptus grandis] Length = 214 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -1 Query: 249 GIYLLFTYFTKPESMEILAETLQADDDVIRSSSFKIRKRK 130 GIYLLFTYFTKPES+E L TL DDDVIRSS+FKIRKRK Sbjct: 174 GIYLLFTYFTKPESIETLEATLNTDDDVIRSSTFKIRKRK 213 >gb|KCW77424.1| hypothetical protein EUGRSUZ_D01771, partial [Eucalyptus grandis] Length = 226 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -1 Query: 249 GIYLLFTYFTKPESMEILAETLQADDDVIRSSSFKIRKRK 130 GIYLLFTYFTKPES+E L TL DDDVIRSS+FKIRKRK Sbjct: 186 GIYLLFTYFTKPESIETLEATLNTDDDVIRSSTFKIRKRK 225 >ref|XP_009358639.1| PREDICTED: 30S ribosomal protein S6 alpha, chloroplastic [Pyrus x bretschneideri] Length = 203 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -1 Query: 249 GIYLLFTYFTKPESMEILAETLQADDDVIRSSSFKIRKRK 130 GIYLLFTYFTKPES+EIL L+ADD+VIRS SFKIRKRK Sbjct: 163 GIYLLFTYFTKPESLEILEANLKADDNVIRSMSFKIRKRK 202 >ref|XP_011654693.1| PREDICTED: 30S ribosomal protein S6 alpha, chloroplastic [Cucumis sativus] gi|700194833|gb|KGN50010.1| hypothetical protein Csa_5G148810 [Cucumis sativus] Length = 210 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -1 Query: 249 GIYLLFTYFTKPESMEILAETLQADDDVIRSSSFKIRKRK 130 GI LLFTYFTKPESM +L TLQADDDV+RS SFK+RKRK Sbjct: 170 GINLLFTYFTKPESMAVLEATLQADDDVVRSMSFKVRKRK 209 >ref|XP_008337563.1| PREDICTED: 30S ribosomal protein S6 alpha, chloroplastic-like [Malus domestica] Length = 203 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -1 Query: 249 GIYLLFTYFTKPESMEILAETLQADDDVIRSSSFKIRKRK 130 GIYLLFTYFTKPES+E+L L+ADD+VIRS SFKIRKRK Sbjct: 163 GIYLLFTYFTKPESLEVLEANLKADDNVIRSMSFKIRKRK 202