BLASTX nr result
ID: Forsythia22_contig00022144
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00022144 (481 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009764368.1| PREDICTED: cysteine-rich and transmembrane d... 83 6e-14 ref|XP_009600875.1| PREDICTED: cysteine-rich and transmembrane d... 82 1e-13 ref|XP_002308904.2| hypothetical protein POPTR_0006s04180g [Popu... 72 2e-10 ref|XP_002531502.1| conserved hypothetical protein [Ricinus comm... 70 4e-10 gb|KJB35914.1| hypothetical protein B456_006G133500 [Gossypium r... 70 6e-10 ref|XP_006421267.1| hypothetical protein CICLE_v10006402mg [Citr... 69 9e-10 emb|CBI30080.3| unnamed protein product [Vitis vinifera] 68 3e-09 ref|XP_009349066.1| PREDICTED: cysteine-rich and transmembrane d... 66 8e-09 gb|KFK24859.1| hypothetical protein AALP_AA8G034200 [Arabis alpina] 65 2e-08 ref|XP_002871075.1| hypothetical protein ARALYDRAFT_908293 [Arab... 65 2e-08 ref|NP_196028.2| uncharacterized protein [Arabidopsis thaliana] ... 65 2e-08 ref|XP_011467336.1| PREDICTED: cysteine-rich and transmembrane d... 64 3e-08 gb|KCW47871.1| hypothetical protein EUGRSUZ_K01615 [Eucalyptus g... 64 4e-08 ref|XP_006398866.1| hypothetical protein EUTSA_v10015225mg [Eutr... 64 5e-08 ref|XP_006398865.1| hypothetical protein EUTSA_v10015225mg [Eutr... 64 5e-08 emb|CDX70261.1| BnaA10g26100D [Brassica napus] 63 9e-08 emb|CDY41401.1| BnaCnng10370D [Brassica napus] 63 9e-08 gb|KMT15127.1| hypothetical protein BVRB_3g062450 [Beta vulgaris... 62 1e-07 ref|XP_010543520.1| PREDICTED: cysteine-rich and transmembrane d... 62 2e-07 ref|XP_008359585.1| PREDICTED: CYSTM1 family protein A-like [Mal... 62 2e-07 >ref|XP_009764368.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Nicotiana sylvestris] Length = 62 Score = 83.2 bits (204), Expect = 6e-14 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -2 Query: 351 KKSKMKCWPRTKPKGERGFLEGCLFALCCCWVCEVCF 241 K KMKC+PR+KPKGERGFLEGCLFALCCCW+CEVCF Sbjct: 25 KNKKMKCFPRSKPKGERGFLEGCLFALCCCWICEVCF 61 >ref|XP_009600875.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Nicotiana tomentosiformis] Length = 61 Score = 82.0 bits (201), Expect = 1e-13 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -2 Query: 351 KKSKMKCWPRTKPKGERGFLEGCLFALCCCWVCEVCF 241 K KMKC+P++KPKGERGFLEGCLFALCCCW+CEVCF Sbjct: 25 KNKKMKCFPKSKPKGERGFLEGCLFALCCCWICEVCF 61 >ref|XP_002308904.2| hypothetical protein POPTR_0006s04180g [Populus trichocarpa] gi|550335432|gb|EEE92427.2| hypothetical protein POPTR_0006s04180g [Populus trichocarpa] Length = 94 Score = 71.6 bits (174), Expect = 2e-10 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 336 KCWPRTKPKGERGFLEGCLFALCCCWVCEVC 244 KC+PRTK KGERGF+EGCLFALCCCW+CE+C Sbjct: 63 KCFPRTKKKGERGFIEGCLFALCCCWICEMC 93 >ref|XP_002531502.1| conserved hypothetical protein [Ricinus communis] gi|223528889|gb|EEF30889.1| conserved hypothetical protein [Ricinus communis] Length = 56 Score = 70.5 bits (171), Expect = 4e-10 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -2 Query: 345 SKMKCWPRTKPKGERGFLEGCLFALCCCWVCEVCF 241 +K KC P TK KG+RGF+EGCLFALCCCW+CE CF Sbjct: 22 AKKKCCPNTKKKGDRGFIEGCLFALCCCWLCEACF 56 >gb|KJB35914.1| hypothetical protein B456_006G133500 [Gossypium raimondii] Length = 60 Score = 70.1 bits (170), Expect = 6e-10 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -2 Query: 336 KCWPRTKPKGERGFLEGCLFALCCCWVCEVCF 241 KC+PR+K KG+RGF+EGCLFALCCCW+CE CF Sbjct: 29 KCFPRSKKKGDRGFIEGCLFALCCCWLCETCF 60 >ref|XP_006421267.1| hypothetical protein CICLE_v10006402mg [Citrus clementina] gi|557523140|gb|ESR34507.1| hypothetical protein CICLE_v10006402mg [Citrus clementina] Length = 60 Score = 69.3 bits (168), Expect = 9e-10 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -2 Query: 348 KSKMKCWPRTKPKGERGFLEGCLFALCCCWVCEVCF 241 K K KC +TK KG+RGF+EGCLFALCCCW+CE CF Sbjct: 25 KGKKKCLSQTKKKGDRGFIEGCLFALCCCWLCEACF 60 >emb|CBI30080.3| unnamed protein product [Vitis vinifera] Length = 56 Score = 67.8 bits (164), Expect = 3e-09 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -2 Query: 333 CWPRTKPKGERGFLEGCLFALCCCWVCEVCF 241 C PR+K KG+RGF+EGCLFALCCCW+CE CF Sbjct: 26 CCPRSKSKGDRGFIEGCLFALCCCWICEACF 56 >ref|XP_009349066.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Pyrus x bretschneideri] Length = 61 Score = 66.2 bits (160), Expect = 8e-09 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -2 Query: 327 PRTKPKGERGFLEGCLFALCCCWVCEVCF 241 PRTK KGERGF+EGCLFALCCCW+CE CF Sbjct: 33 PRTKAKGERGFIEGCLFALCCCWLCEECF 61 >gb|KFK24859.1| hypothetical protein AALP_AA8G034200 [Arabis alpina] Length = 67 Score = 65.1 bits (157), Expect = 2e-08 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -2 Query: 351 KKSKMKCWPRTKPKGERGFLEGCLFALCCCWVCEVCF 241 KK K + TK KG+RGF+EGCLFALCCCW+CE+CF Sbjct: 31 KKKKKPRFFETKEKGDRGFIEGCLFALCCCWICEMCF 67 >ref|XP_002871075.1| hypothetical protein ARALYDRAFT_908293 [Arabidopsis lyrata subsp. lyrata] gi|297316912|gb|EFH47334.1| hypothetical protein ARALYDRAFT_908293 [Arabidopsis lyrata subsp. lyrata] Length = 64 Score = 65.1 bits (157), Expect = 2e-08 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -2 Query: 351 KKSKMKCWPRTKPKGERGFLEGCLFALCCCWVCEVCF 241 KK K + TK KG+RGF+EGCLFALCCCW+CE+CF Sbjct: 28 KKKKKPRFFETKKKGDRGFIEGCLFALCCCWICEMCF 64 >ref|NP_196028.2| uncharacterized protein [Arabidopsis thaliana] gi|38603900|gb|AAR24695.1| At5g04080 [Arabidopsis thaliana] gi|41349906|gb|AAS00338.1| At5g04080 [Arabidopsis thaliana] gi|332003311|gb|AED90694.1| uncharacterized protein AT5G04080 [Arabidopsis thaliana] Length = 63 Score = 65.1 bits (157), Expect = 2e-08 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -2 Query: 351 KKSKMKCWPRTKPKGERGFLEGCLFALCCCWVCEVCF 241 KK K + TK KG+RGF+EGCLFALCCCW+CE+CF Sbjct: 27 KKKKKPRFFETKQKGDRGFIEGCLFALCCCWICEMCF 63 >ref|XP_011467336.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Fragaria vesca subsp. vesca] Length = 59 Score = 64.3 bits (155), Expect = 3e-08 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -2 Query: 345 SKMKCWPRTKPKGERGFLEGCLFALCCCWVCEVCF 241 ++ K P+TK KG+RGF+EGCLFALCCCW+CE CF Sbjct: 25 TRKKFRPQTKKKGDRGFIEGCLFALCCCWLCEECF 59 >gb|KCW47871.1| hypothetical protein EUGRSUZ_K01615 [Eucalyptus grandis] Length = 137 Score = 63.9 bits (154), Expect = 4e-08 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 3/39 (7%) Frame = -2 Query: 351 KKSKMKCWPRTKPKG---ERGFLEGCLFALCCCWVCEVC 244 +KSK+ C RTK KG ERGF+EGCLFALCCCW+CE C Sbjct: 97 RKSKLLCCSRTKMKGDSRERGFIEGCLFALCCCWLCEEC 135 >ref|XP_006398866.1| hypothetical protein EUTSA_v10015225mg [Eutrema salsugineum] gi|557099956|gb|ESQ40319.1| hypothetical protein EUTSA_v10015225mg [Eutrema salsugineum] Length = 64 Score = 63.5 bits (153), Expect = 5e-08 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = -2 Query: 324 RTKPKGERGFLEGCLFALCCCWVCEVCF 241 +TK KG+RGF+EGCLFALCCCWVCE+CF Sbjct: 37 KTKQKGDRGFIEGCLFALCCCWVCEMCF 64 >ref|XP_006398865.1| hypothetical protein EUTSA_v10015225mg [Eutrema salsugineum] gi|557099955|gb|ESQ40318.1| hypothetical protein EUTSA_v10015225mg [Eutrema salsugineum] Length = 59 Score = 63.5 bits (153), Expect = 5e-08 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = -2 Query: 324 RTKPKGERGFLEGCLFALCCCWVCEVCF 241 +TK KG+RGF+EGCLFALCCCWVCE+CF Sbjct: 32 KTKQKGDRGFIEGCLFALCCCWVCEMCF 59 >emb|CDX70261.1| BnaA10g26100D [Brassica napus] Length = 65 Score = 62.8 bits (151), Expect = 9e-08 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -2 Query: 348 KSKMKCWPRTKPKGERGFLEGCLFALCCCWVCEVCF 241 K+K K + TK KG+RGF+EGCLFALCCCW+CE+CF Sbjct: 31 KNKKKPF-ETKQKGDRGFIEGCLFALCCCWICEMCF 65 >emb|CDY41401.1| BnaCnng10370D [Brassica napus] Length = 65 Score = 62.8 bits (151), Expect = 9e-08 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -2 Query: 348 KSKMKCWPRTKPKGERGFLEGCLFALCCCWVCEVCF 241 K+K K + TK KG+RGF+EGCLFALCCCW+CE+CF Sbjct: 31 KNKKKPF-ETKQKGDRGFIEGCLFALCCCWICEMCF 65 >gb|KMT15127.1| hypothetical protein BVRB_3g062450 [Beta vulgaris subsp. vulgaris] Length = 69 Score = 62.4 bits (150), Expect = 1e-07 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = -2 Query: 348 KSKMKCWPRTKPKGERGFLEGCLFALCCCWVCEVC 244 K K K W RTK +GE+GF+EGCL LCCCW+CE C Sbjct: 33 KMKKKSWFRTKKRGEKGFIEGCLAGLCCCWICEEC 67 >ref|XP_010543520.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Tarenaya hassleriana] Length = 65 Score = 62.0 bits (149), Expect = 2e-07 Identities = 25/38 (65%), Positives = 30/38 (78%), Gaps = 2/38 (5%) Frame = -2 Query: 351 KKSKMKCWPR--TKPKGERGFLEGCLFALCCCWVCEVC 244 +K K K P TK KG+RGF+EGCLFALCCCW+CE+C Sbjct: 27 EKKKKKLLPSFGTKQKGDRGFIEGCLFALCCCWICEMC 64 >ref|XP_008359585.1| PREDICTED: CYSTM1 family protein A-like [Malus domestica] Length = 58 Score = 62.0 bits (149), Expect = 2e-07 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -2 Query: 327 PRTKPKGERGFLEGCLFALCCCWVCEVCF 241 P TK KG+RGF+EGCLFALCCCW+CE CF Sbjct: 30 PWTKKKGDRGFIEGCLFALCCCWLCEECF 58