BLASTX nr result
ID: Forsythia22_contig00022038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00022038 (213 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532506.1| scythe/bat3, putative [Ricinus communis] gi|... 58 3e-06 emb|CDP18808.1| unnamed protein product [Coffea canephora] 57 4e-06 ref|XP_012081118.1| PREDICTED: large proline-rich protein bag6-l... 57 5e-06 ref|XP_012081115.1| PREDICTED: large proline-rich protein bag6-l... 57 5e-06 ref|XP_010244866.1| PREDICTED: large proline-rich protein BAG6-l... 57 5e-06 ref|XP_008242909.1| PREDICTED: large proline-rich protein bag6-A... 57 5e-06 ref|XP_012081116.1| PREDICTED: large proline-rich protein bag6-l... 57 5e-06 ref|XP_010244742.1| PREDICTED: uncharacterized protein LOC104588... 57 6e-06 ref|XP_010244741.1| PREDICTED: large proline-rich protein BAG6-l... 57 6e-06 ref|XP_010049900.1| PREDICTED: large proline-rich protein BAG6 i... 56 8e-06 ref|XP_010049899.1| PREDICTED: large proline-rich protein BAG6 i... 56 8e-06 gb|KCW82727.1| hypothetical protein EUGRSUZ_C04105 [Eucalyptus g... 56 8e-06 gb|KCW82726.1| hypothetical protein EUGRSUZ_C04105 [Eucalyptus g... 56 8e-06 >ref|XP_002532506.1| scythe/bat3, putative [Ricinus communis] gi|223527781|gb|EEF29882.1| scythe/bat3, putative [Ricinus communis] Length = 709 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 213 DQLLSAYHVEDGHTLHLIVRQPVIPSGFG 127 DQLLSAYHVEDGHTLHL+VRQPVIPS G Sbjct: 74 DQLLSAYHVEDGHTLHLVVRQPVIPSSDG 102 >emb|CDP18808.1| unnamed protein product [Coffea canephora] Length = 714 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 213 DQLLSAYHVEDGHTLHLIVRQPVIPSGFG 127 DQLLSAYHVEDGHTLHL+VRQPV+PS G Sbjct: 76 DQLLSAYHVEDGHTLHLVVRQPVVPSSEG 104 >ref|XP_012081118.1| PREDICTED: large proline-rich protein bag6-like isoform X3 [Jatropha curcas] Length = 712 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 213 DQLLSAYHVEDGHTLHLIVRQPVIPSGFG 127 DQLLSAYHVEDGHTLHL+VRQPV+PS G Sbjct: 85 DQLLSAYHVEDGHTLHLVVRQPVLPSSDG 113 >ref|XP_012081115.1| PREDICTED: large proline-rich protein bag6-like isoform X1 [Jatropha curcas] Length = 729 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 213 DQLLSAYHVEDGHTLHLIVRQPVIPSGFG 127 DQLLSAYHVEDGHTLHL+VRQPV+PS G Sbjct: 85 DQLLSAYHVEDGHTLHLVVRQPVLPSSDG 113 >ref|XP_010244866.1| PREDICTED: large proline-rich protein BAG6-like [Nelumbo nucifera] Length = 794 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -1 Query: 213 DQLLSAYHVEDGHTLHLIVRQPVIPSGFGHAGFM 112 DQLLSAYHVEDGHTLHL+VRQPV PS GF+ Sbjct: 105 DQLLSAYHVEDGHTLHLVVRQPVPPSSASTMGFI 138 >ref|XP_008242909.1| PREDICTED: large proline-rich protein bag6-A [Prunus mume] Length = 730 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 213 DQLLSAYHVEDGHTLHLIVRQPVIPSGFG 127 DQLLSAYHVEDGHTLHL+VRQPV+PS G Sbjct: 74 DQLLSAYHVEDGHTLHLVVRQPVLPSSEG 102 >ref|XP_012081116.1| PREDICTED: large proline-rich protein bag6-like isoform X2 [Jatropha curcas] gi|802665712|ref|XP_012081117.1| PREDICTED: large proline-rich protein bag6-like isoform X2 [Jatropha curcas] gi|643719318|gb|KDP30188.1| hypothetical protein JCGZ_16970 [Jatropha curcas] Length = 718 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 213 DQLLSAYHVEDGHTLHLIVRQPVIPSGFG 127 DQLLSAYHVEDGHTLHL+VRQPV+PS G Sbjct: 74 DQLLSAYHVEDGHTLHLVVRQPVLPSSDG 102 >ref|XP_010244742.1| PREDICTED: uncharacterized protein LOC104588496 isoform X2 [Nelumbo nucifera] Length = 676 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -1 Query: 213 DQLLSAYHVEDGHTLHLIVRQPVIPSGFGHAGFM 112 DQLLSAYHVEDGHTLHL+VRQPV P GFM Sbjct: 76 DQLLSAYHVEDGHTLHLVVRQPVPPPSASTMGFM 109 >ref|XP_010244741.1| PREDICTED: large proline-rich protein BAG6-like isoform X1 [Nelumbo nucifera] Length = 684 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -1 Query: 213 DQLLSAYHVEDGHTLHLIVRQPVIPSGFGHAGFM 112 DQLLSAYHVEDGHTLHL+VRQPV P GFM Sbjct: 76 DQLLSAYHVEDGHTLHLVVRQPVPPPSASTMGFM 109 >ref|XP_010049900.1| PREDICTED: large proline-rich protein BAG6 isoform X2 [Eucalyptus grandis] Length = 724 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 213 DQLLSAYHVEDGHTLHLIVRQPVIPSGFGHAG 118 DQLLSAYHVEDGHTLHL+VRQPV PS G G Sbjct: 74 DQLLSAYHVEDGHTLHLVVRQPVPPSSEGAPG 105 >ref|XP_010049899.1| PREDICTED: large proline-rich protein BAG6 isoform X1 [Eucalyptus grandis] Length = 727 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 213 DQLLSAYHVEDGHTLHLIVRQPVIPSGFGHAG 118 DQLLSAYHVEDGHTLHL+VRQPV PS G G Sbjct: 74 DQLLSAYHVEDGHTLHLVVRQPVPPSSEGAPG 105 >gb|KCW82727.1| hypothetical protein EUGRSUZ_C04105 [Eucalyptus grandis] Length = 747 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 213 DQLLSAYHVEDGHTLHLIVRQPVIPSGFGHAG 118 DQLLSAYHVEDGHTLHL+VRQPV PS G G Sbjct: 74 DQLLSAYHVEDGHTLHLVVRQPVPPSSEGAPG 105 >gb|KCW82726.1| hypothetical protein EUGRSUZ_C04105 [Eucalyptus grandis] Length = 744 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 213 DQLLSAYHVEDGHTLHLIVRQPVIPSGFGHAG 118 DQLLSAYHVEDGHTLHL+VRQPV PS G G Sbjct: 74 DQLLSAYHVEDGHTLHLVVRQPVPPSSEGAPG 105