BLASTX nr result
ID: Forsythia22_contig00022009
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00022009 (544 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011087828.1| PREDICTED: tRNA (guanine(10)-N2)-methyltrans... 58 3e-06 >ref|XP_011087828.1| PREDICTED: tRNA (guanine(10)-N2)-methyltransferase homolog [Sesamum indicum] Length = 474 Score = 57.8 bits (138), Expect = 3e-06 Identities = 33/58 (56%), Positives = 38/58 (65%) Frame = -3 Query: 542 DKKILQTIN*KAANILAEQQWMQKKAFLMANQAQVRFWILVYYPFVGT*SIMIATAHF 369 D+KILQT K+ L + AFLMANQAQV+ LVY PFVGT SI+IA AHF Sbjct: 181 DRKILQTYQLKSRKYLGPTAMDAEMAFLMANQAQVKPGKLVYDPFVGTGSILIAAAHF 238