BLASTX nr result
ID: Forsythia22_contig00021954
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00021954 (451 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP18462.1| unnamed protein product [Coffea canephora] 60 4e-07 ref|XP_012828743.1| PREDICTED: conserved oligomeric Golgi comple... 59 1e-06 ref|XP_011094283.1| PREDICTED: conserved oligomeric Golgi comple... 58 3e-06 >emb|CDP18462.1| unnamed protein product [Coffea canephora] Length = 1127 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -3 Query: 341 KLGSILIDGQVGRFGDILPAQATGLLPSFTAARLD 237 +LGSIL DGQVGRFGD+LPAQA GLL SFTA RLD Sbjct: 1092 RLGSILTDGQVGRFGDMLPAQAAGLLSSFTAGRLD 1126 >ref|XP_012828743.1| PREDICTED: conserved oligomeric Golgi complex subunit 1 [Erythranthe guttatus] gi|604297991|gb|EYU18079.1| hypothetical protein MIMGU_mgv1a000581mg [Erythranthe guttata] Length = 1060 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -3 Query: 341 KLGSILIDGQVGRFGDILPAQATGLLPSFTAARLDF 234 +LGS+L DGQVGRFGDILPAQA GLL SFT AR D+ Sbjct: 1025 RLGSMLTDGQVGRFGDILPAQAAGLLSSFTTARSDY 1060 >ref|XP_011094283.1| PREDICTED: conserved oligomeric Golgi complex subunit 1 [Sesamum indicum] Length = 1061 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -3 Query: 341 KLGSILIDGQVGRFGDILPAQATGLLPSFTAARLD 237 +LGS+L DGQVGRFGDILPA A GLL SFTAAR D Sbjct: 1026 RLGSMLTDGQVGRFGDILPANAAGLLSSFTAARSD 1060