BLASTX nr result
ID: Forsythia22_contig00020937
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00020937 (456 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012840359.1| PREDICTED: ATP-citrate synthase beta chain p... 140 3e-31 ref|XP_012846622.1| PREDICTED: ATP-citrate synthase beta chain p... 140 3e-31 ref|XP_007154379.1| hypothetical protein PHAVU_003G114300g, part... 140 4e-31 gb|AGV54464.1| ATP-citrate synthase beta chain protein 1-like pr... 140 4e-31 ref|XP_011019965.1| PREDICTED: ATP-citrate synthase beta chain p... 139 1e-30 ref|XP_002312331.1| subunit B of the trimeric enzyme ATP Citrate... 139 1e-30 ref|XP_004229010.1| PREDICTED: ATP-citrate synthase beta chain p... 138 2e-30 ref|XP_011071378.1| PREDICTED: ATP-citrate synthase beta chain p... 137 2e-30 gb|KJB72831.1| hypothetical protein B456_011G200100 [Gossypium r... 137 3e-30 ref|XP_012455352.1| PREDICTED: ATP-citrate synthase beta chain p... 137 3e-30 gb|KHG23323.1| ATP-citrate synthase beta chain 2 -like protein [... 137 3e-30 ref|XP_010482219.1| PREDICTED: ATP-citrate synthase beta chain p... 137 3e-30 ref|XP_010464245.1| PREDICTED: ATP-citrate synthase beta chain p... 137 3e-30 ref|XP_010442412.1| PREDICTED: ATP-citrate synthase beta chain p... 137 3e-30 ref|XP_010440587.1| PREDICTED: ATP-citrate synthase beta chain p... 137 3e-30 ref|XP_010267949.1| PREDICTED: ATP-citrate synthase beta chain p... 137 3e-30 ref|XP_009111879.1| PREDICTED: ATP-citrate synthase beta chain p... 137 3e-30 emb|CDY00032.1| BnaC09g02690D [Brassica napus] 137 3e-30 emb|CDY68764.1| BnaAnng28310D, partial [Brassica napus] 137 3e-30 emb|CDO98761.1| unnamed protein product [Coffea canephora] 137 3e-30 >ref|XP_012840359.1| PREDICTED: ATP-citrate synthase beta chain protein 2-like [Erythranthe guttatus] gi|604347244|gb|EYU45496.1| hypothetical protein MIMGU_mgv1a003086mg [Erythranthe guttata] Length = 609 Score = 140 bits (353), Expect = 3e-31 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = -1 Query: 456 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 277 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP Sbjct: 542 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 601 Query: 276 WEDVLYTK 253 WEDVLYTK Sbjct: 602 WEDVLYTK 609 >ref|XP_012846622.1| PREDICTED: ATP-citrate synthase beta chain protein 1 [Erythranthe guttatus] gi|848893145|ref|XP_012846623.1| PREDICTED: ATP-citrate synthase beta chain protein 1 [Erythranthe guttatus] gi|848893147|ref|XP_012846624.1| PREDICTED: ATP-citrate synthase beta chain protein 1 [Erythranthe guttatus] gi|848893149|ref|XP_012846625.1| PREDICTED: ATP-citrate synthase beta chain protein 1 [Erythranthe guttatus] gi|848893151|ref|XP_012846626.1| PREDICTED: ATP-citrate synthase beta chain protein 1 [Erythranthe guttatus] gi|604317911|gb|EYU29663.1| hypothetical protein MIMGU_mgv1a003097mg [Erythranthe guttata] gi|604317912|gb|EYU29664.1| hypothetical protein MIMGU_mgv1a003097mg [Erythranthe guttata] Length = 608 Score = 140 bits (353), Expect = 3e-31 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = -1 Query: 456 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 277 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP Sbjct: 541 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 600 Query: 276 WEDVLYTK 253 WEDVLYTK Sbjct: 601 WEDVLYTK 608 >ref|XP_007154379.1| hypothetical protein PHAVU_003G114300g, partial [Phaseolus vulgaris] gi|561027733|gb|ESW26373.1| hypothetical protein PHAVU_003G114300g, partial [Phaseolus vulgaris] Length = 553 Score = 140 bits (352), Expect = 4e-31 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = -1 Query: 456 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 277 AIGSLFLDLLAGSGMFTKQE+DEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP Sbjct: 486 AIGSLFLDLLAGSGMFTKQEVDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 545 Query: 276 WEDVLYTK 253 WEDVLYTK Sbjct: 546 WEDVLYTK 553 >gb|AGV54464.1| ATP-citrate synthase beta chain protein 1-like protein [Phaseolus vulgaris] Length = 608 Score = 140 bits (352), Expect = 4e-31 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = -1 Query: 456 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 277 AIGSLFLDLLAGSGMFTKQE+DEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP Sbjct: 541 AIGSLFLDLLAGSGMFTKQEVDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 600 Query: 276 WEDVLYTK 253 WEDVLYTK Sbjct: 601 WEDVLYTK 608 >ref|XP_011019965.1| PREDICTED: ATP-citrate synthase beta chain protein 2 [Populus euphratica] gi|743783570|ref|XP_011019973.1| PREDICTED: ATP-citrate synthase beta chain protein 2 [Populus euphratica] gi|743783572|ref|XP_011019981.1| PREDICTED: ATP-citrate synthase beta chain protein 2 [Populus euphratica] Length = 608 Score = 139 bits (349), Expect = 1e-30 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = -1 Query: 456 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 277 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP Sbjct: 541 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 600 Query: 276 WEDVLYTK 253 WEDVLY+K Sbjct: 601 WEDVLYSK 608 >ref|XP_002312331.1| subunit B of the trimeric enzyme ATP Citrate lyase family protein [Populus trichocarpa] gi|222852151|gb|EEE89698.1| subunit B of the trimeric enzyme ATP Citrate lyase family protein [Populus trichocarpa] Length = 608 Score = 139 bits (349), Expect = 1e-30 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = -1 Query: 456 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 277 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP Sbjct: 541 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 600 Query: 276 WEDVLYTK 253 WEDVLY+K Sbjct: 601 WEDVLYSK 608 >ref|XP_004229010.1| PREDICTED: ATP-citrate synthase beta chain protein 2-like [Solanum lycopersicum] gi|723656979|ref|XP_010318987.1| PREDICTED: ATP-citrate synthase beta chain protein 2-like [Solanum lycopersicum] gi|723656982|ref|XP_010318991.1| PREDICTED: ATP-citrate synthase beta chain protein 2-like [Solanum lycopersicum] Length = 608 Score = 138 bits (347), Expect = 2e-30 Identities = 67/68 (98%), Positives = 67/68 (98%) Frame = -1 Query: 456 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 277 AIGSLFLDLLAGSGMFTK EIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP Sbjct: 541 AIGSLFLDLLAGSGMFTKPEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 600 Query: 276 WEDVLYTK 253 WEDVLYTK Sbjct: 601 WEDVLYTK 608 >ref|XP_011071378.1| PREDICTED: ATP-citrate synthase beta chain protein 2 [Sesamum indicum] gi|747050600|ref|XP_011071379.1| PREDICTED: ATP-citrate synthase beta chain protein 2 [Sesamum indicum] gi|747050602|ref|XP_011071380.1| PREDICTED: ATP-citrate synthase beta chain protein 2 [Sesamum indicum] gi|747050604|ref|XP_011071381.1| PREDICTED: ATP-citrate synthase beta chain protein 2 [Sesamum indicum] Length = 608 Score = 137 bits (346), Expect = 2e-30 Identities = 66/68 (97%), Positives = 67/68 (98%) Frame = -1 Query: 456 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 277 AIGSLFLDLLAGSGMFTKQEIDEI+ IGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP Sbjct: 541 AIGSLFLDLLAGSGMFTKQEIDEIIAIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 600 Query: 276 WEDVLYTK 253 WEDVLYTK Sbjct: 601 WEDVLYTK 608 >gb|KJB72831.1| hypothetical protein B456_011G200100 [Gossypium raimondii] Length = 610 Score = 137 bits (345), Expect = 3e-30 Identities = 67/68 (98%), Positives = 67/68 (98%) Frame = -1 Query: 456 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 277 AIGSLFLDLLAGSGMFTKQEIDEIV IGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP Sbjct: 543 AIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 602 Query: 276 WEDVLYTK 253 WEDVLYTK Sbjct: 603 WEDVLYTK 610 >ref|XP_012455352.1| PREDICTED: ATP-citrate synthase beta chain protein 2 [Gossypium raimondii] gi|763805891|gb|KJB72829.1| hypothetical protein B456_011G200100 [Gossypium raimondii] gi|763805894|gb|KJB72832.1| hypothetical protein B456_011G200100 [Gossypium raimondii] Length = 608 Score = 137 bits (345), Expect = 3e-30 Identities = 67/68 (98%), Positives = 67/68 (98%) Frame = -1 Query: 456 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 277 AIGSLFLDLLAGSGMFTKQEIDEIV IGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP Sbjct: 541 AIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 600 Query: 276 WEDVLYTK 253 WEDVLYTK Sbjct: 601 WEDVLYTK 608 >gb|KHG23323.1| ATP-citrate synthase beta chain 2 -like protein [Gossypium arboreum] Length = 608 Score = 137 bits (345), Expect = 3e-30 Identities = 67/68 (98%), Positives = 67/68 (98%) Frame = -1 Query: 456 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 277 AIGSLFLDLLAGSGMFTKQEIDEIV IGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP Sbjct: 541 AIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 600 Query: 276 WEDVLYTK 253 WEDVLYTK Sbjct: 601 WEDVLYTK 608 >ref|XP_010482219.1| PREDICTED: ATP-citrate synthase beta chain protein 2-like [Camelina sativa] Length = 608 Score = 137 bits (345), Expect = 3e-30 Identities = 67/68 (98%), Positives = 67/68 (98%) Frame = -1 Query: 456 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 277 AIGSLFLDLLAGSGMFTKQEIDEIV IGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP Sbjct: 541 AIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 600 Query: 276 WEDVLYTK 253 WEDVLYTK Sbjct: 601 WEDVLYTK 608 >ref|XP_010464245.1| PREDICTED: ATP-citrate synthase beta chain protein 1-like [Camelina sativa] Length = 608 Score = 137 bits (345), Expect = 3e-30 Identities = 67/68 (98%), Positives = 67/68 (98%) Frame = -1 Query: 456 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 277 AIGSLFLDLLAGSGMFTKQEIDEIV IGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP Sbjct: 541 AIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 600 Query: 276 WEDVLYTK 253 WEDVLYTK Sbjct: 601 WEDVLYTK 608 >ref|XP_010442412.1| PREDICTED: ATP-citrate synthase beta chain protein 2 [Camelina sativa] Length = 608 Score = 137 bits (345), Expect = 3e-30 Identities = 67/68 (98%), Positives = 67/68 (98%) Frame = -1 Query: 456 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 277 AIGSLFLDLLAGSGMFTKQEIDEIV IGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP Sbjct: 541 AIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 600 Query: 276 WEDVLYTK 253 WEDVLYTK Sbjct: 601 WEDVLYTK 608 >ref|XP_010440587.1| PREDICTED: ATP-citrate synthase beta chain protein 2-like [Camelina sativa] gi|727422269|ref|XP_010440596.1| PREDICTED: ATP-citrate synthase beta chain protein 2-like [Camelina sativa] Length = 608 Score = 137 bits (345), Expect = 3e-30 Identities = 67/68 (98%), Positives = 67/68 (98%) Frame = -1 Query: 456 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 277 AIGSLFLDLLAGSGMFTKQEIDEIV IGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP Sbjct: 541 AIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 600 Query: 276 WEDVLYTK 253 WEDVLYTK Sbjct: 601 WEDVLYTK 608 >ref|XP_010267949.1| PREDICTED: ATP-citrate synthase beta chain protein 2 [Nelumbo nucifera] Length = 608 Score = 137 bits (345), Expect = 3e-30 Identities = 67/68 (98%), Positives = 67/68 (98%) Frame = -1 Query: 456 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 277 AIGSLFLDLLAGSGMFTKQEIDEIV IGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP Sbjct: 541 AIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 600 Query: 276 WEDVLYTK 253 WEDVLYTK Sbjct: 601 WEDVLYTK 608 >ref|XP_009111879.1| PREDICTED: ATP-citrate synthase beta chain protein 2 [Brassica rapa] gi|685353275|ref|XP_009111880.1| PREDICTED: ATP-citrate synthase beta chain protein 2 [Brassica rapa] Length = 608 Score = 137 bits (345), Expect = 3e-30 Identities = 67/68 (98%), Positives = 67/68 (98%) Frame = -1 Query: 456 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 277 AIGSLFLDLLAGSGMFTKQEIDEIV IGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP Sbjct: 541 AIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 600 Query: 276 WEDVLYTK 253 WEDVLYTK Sbjct: 601 WEDVLYTK 608 >emb|CDY00032.1| BnaC09g02690D [Brassica napus] Length = 729 Score = 137 bits (345), Expect = 3e-30 Identities = 67/68 (98%), Positives = 67/68 (98%) Frame = -1 Query: 456 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 277 AIGSLFLDLLAGSGMFTKQEIDEIV IGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP Sbjct: 662 AIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 721 Query: 276 WEDVLYTK 253 WEDVLYTK Sbjct: 722 WEDVLYTK 729 >emb|CDY68764.1| BnaAnng28310D, partial [Brassica napus] Length = 536 Score = 137 bits (345), Expect = 3e-30 Identities = 67/68 (98%), Positives = 67/68 (98%) Frame = -1 Query: 456 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 277 AIGSLFLDLLAGSGMFTKQEIDEIV IGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP Sbjct: 469 AIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 528 Query: 276 WEDVLYTK 253 WEDVLYTK Sbjct: 529 WEDVLYTK 536 >emb|CDO98761.1| unnamed protein product [Coffea canephora] Length = 608 Score = 137 bits (345), Expect = 3e-30 Identities = 67/68 (98%), Positives = 67/68 (98%) Frame = -1 Query: 456 AIGSLFLDLLAGSGMFTKQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 277 AIGSLFLDLLAGSGMFTKQEIDEIV IGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP Sbjct: 541 AIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP 600 Query: 276 WEDVLYTK 253 WEDVLYTK Sbjct: 601 WEDVLYTK 608