BLASTX nr result
ID: Forsythia22_contig00020777
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00020777 (1282 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004237259.1| cytochrome c biogenesis FN (mitochondrion) [... 62 9e-07 ref|XP_008244833.1| PREDICTED: LOW QUALITY PROTEIN: probable cyt... 61 2e-06 ref|YP_002608347.1| CcmFN [Vitis vinifera] gi|147857544|emb|CAN8... 61 2e-06 gb|AHF22761.1| cytochrome c biogenesis Fn, partial (mitochondrio... 61 2e-06 gb|AHF22759.1| cytochrome c biogenesis Fn, partial (mitochondrio... 61 2e-06 gb|AHF22757.1| cytochrome c biogenesis Fn, partial (mitochondrio... 61 2e-06 gb|AHF22756.1| cytochrome c biogenesis Fn, partial (mitochondrio... 61 2e-06 ref|YP_006666116.1| CcmFN (mitochondrion) [Malus domestica] gi|4... 61 2e-06 ref|XP_011102275.1| PREDICTED: LOW QUALITY PROTEIN: probable cyt... 60 4e-06 ref|YP_006460184.1| cytochrome c maturase subunit Fn (mitochondr... 60 4e-06 gb|AKJ25526.1| cytochrome c maturase subunit Fn (mitochondrion) ... 60 5e-06 gb|AKJ25524.1| cytochrome c maturase subunit Fn (mitochondrion) ... 60 5e-06 gb|AKJ25523.1| cytochrome c maturase subunit Fn (mitochondrion) ... 60 5e-06 gb|AKJ25518.1| cytochrome c maturase subunit Fn (mitochondrion) ... 60 5e-06 gb|AKJ25517.1| cytochrome c maturase subunit Fn (mitochondrion) ... 60 5e-06 gb|AKJ25516.1| cytochrome c maturase subunit Fn (mitochondrion) ... 60 5e-06 gb|AKJ25515.1| cytochrome c maturase subunit Fn (mitochondrion) ... 60 5e-06 gb|AKJ25514.1| cytochrome c maturase subunit Fn (mitochondrion) ... 60 5e-06 gb|AKJ25512.1| cytochrome c maturase subunit Fn (mitochondrion) ... 60 5e-06 gb|AKJ25510.1| cytochrome c maturase subunit Fn (mitochondrion) ... 60 5e-06 >ref|YP_004237259.1| cytochrome c biogenesis FN (mitochondrion) [Ricinus communis] gi|322394266|gb|ADW96023.1| cytochrome c biogenesis FN (mitochondrion) [Ricinus communis] Length = 598 Score = 62.0 bits (149), Expect = 9e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 133 RSRAMSKRGGHRETLFYSFVSNFVKNSILSLSRY 32 +S +SKRGGHRET+FYSFVSNFVKNSILSLSRY Sbjct: 102 QSHNVSKRGGHRETIFYSFVSNFVKNSILSLSRY 135 >ref|XP_008244833.1| PREDICTED: LOW QUALITY PROTEIN: probable cytochrome c biosynthesis protein [Prunus mume] Length = 596 Score = 61.2 bits (147), Expect = 2e-06 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = -1 Query: 154 NYYHFPRR--SRAMSKRGGHRETLFYSFVSNFVKNSILSLSRY 32 ++Y F R S +SKRGGHRETLFYSFVSNFVKNSILSL RY Sbjct: 89 SFYGFLGRPQSHNVSKRGGHRETLFYSFVSNFVKNSILSLPRY 131 >ref|YP_002608347.1| CcmFN [Vitis vinifera] gi|147857544|emb|CAN82856.1| hypothetical protein VITISV_008530 [Vitis vinifera] gi|209954143|emb|CAQ77573.1| ccmFN [Vitis vinifera] gi|239764753|gb|ACS15223.1| CcmFN [Vitis vinifera] Length = 574 Score = 61.2 bits (147), Expect = 2e-06 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = -1 Query: 148 YHFPRRSRAMSKRGGHRETLFYSFVSNFVKNSILSLSRY 32 Y +S +SKRGGHRETLFYSFVSNFVKNSILSL RY Sbjct: 97 YRCRPQSHNVSKRGGHRETLFYSFVSNFVKNSILSLPRY 135 >gb|AHF22761.1| cytochrome c biogenesis Fn, partial (mitochondrion) [Fragaria vesca subsp. vesca] Length = 576 Score = 60.8 bits (146), Expect = 2e-06 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 133 RSRAMSKRGGHRETLFYSFVSNFVKNSILSLSRY 32 +S +SKRGGHRETLFYSFVSNFVKNSILSL RY Sbjct: 102 QSHNVSKRGGHRETLFYSFVSNFVKNSILSLPRY 135 >gb|AHF22759.1| cytochrome c biogenesis Fn, partial (mitochondrion) [Fragaria chiloensis] gi|571034615|gb|AHF22760.1| cytochrome c biogenesis Fn, partial (mitochondrion) [Fragaria virginiana] gi|814606897|gb|AKE33964.1| cytochrome c biogenesis Fn, partial (mitochondrion) [Fragaria virginiana] gi|814606899|gb|AKE33965.1| cytochrome c biogenesis Fn, partial (mitochondrion) [Fragaria chiloensis] Length = 576 Score = 60.8 bits (146), Expect = 2e-06 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 133 RSRAMSKRGGHRETLFYSFVSNFVKNSILSLSRY 32 +S +SKRGGHRETLFYSFVSNFVKNSILSL RY Sbjct: 102 QSHNVSKRGGHRETLFYSFVSNFVKNSILSLPRY 135 >gb|AHF22757.1| cytochrome c biogenesis Fn, partial (mitochondrion) [Fragaria mandshurica] gi|571034611|gb|AHF22758.1| cytochrome c biogenesis Fn, partial (mitochondrion) [Fragaria vesca subsp. bracteata] gi|571034619|gb|AHF22762.1| cytochrome c biogenesis Fn, partial (mitochondrion) [Fragaria vesca subsp. bracteata] gi|571034621|gb|AHF22763.1| cytochrome c biogenesis Fn, partial (mitochondrion) [Fragaria vesca subsp. bracteata] gi|814606889|gb|AKE33960.1| cytochrome c biogenesis Fn, partial (mitochondrion) [Fragaria mandshurica] gi|814606891|gb|AKE33961.1| cytochrome c biogenesis Fn, partial (mitochondrion) [Fragaria vesca subsp. bracteata] gi|814606895|gb|AKE33963.1| cytochrome c biogenesis Fn, partial (mitochondrion) [Fragaria vesca subsp. bracteata] Length = 576 Score = 60.8 bits (146), Expect = 2e-06 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 133 RSRAMSKRGGHRETLFYSFVSNFVKNSILSLSRY 32 +S +SKRGGHRETLFYSFVSNFVKNSILSL RY Sbjct: 102 QSHNVSKRGGHRETLFYSFVSNFVKNSILSLPRY 135 >gb|AHF22756.1| cytochrome c biogenesis Fn, partial (mitochondrion) [Fragaria iinumae] gi|814606893|gb|AKE33962.1| cytochrome c biogenesis Fn, partial (mitochondrion) [Fragaria iinumae] Length = 576 Score = 60.8 bits (146), Expect = 2e-06 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 133 RSRAMSKRGGHRETLFYSFVSNFVKNSILSLSRY 32 +S +SKRGGHRETLFYSFVSNFVKNSILSL RY Sbjct: 102 QSHNVSKRGGHRETLFYSFVSNFVKNSILSLPRY 135 >ref|YP_006666116.1| CcmFN (mitochondrion) [Malus domestica] gi|401661921|emb|CBX33376.1| ccmFN (mitochondrion) [Malus domestica] Length = 587 Score = 60.8 bits (146), Expect = 2e-06 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 133 RSRAMSKRGGHRETLFYSFVSNFVKNSILSLSRY 32 +S +SKRGGHRETLFYSFVSNFVKNSILSL RY Sbjct: 116 QSHNVSKRGGHRETLFYSFVSNFVKNSILSLPRY 149 >ref|XP_011102275.1| PREDICTED: LOW QUALITY PROTEIN: probable cytochrome c biosynthesis protein [Sesamum indicum] Length = 598 Score = 60.1 bits (144), Expect = 4e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 133 RSRAMSKRGGHRETLFYSFVSNFVKNSILSLSRY 32 +S +SKRGGHRETLFYSF+SNFVKNSILSL RY Sbjct: 102 KSHNVSKRGGHRETLFYSFLSNFVKNSILSLPRY 135 >ref|YP_006460184.1| cytochrome c maturase subunit Fn (mitochondrion) (mitochondrion) [Erythranthe guttata] gi|340007649|gb|AEK26513.1| cytochrome c maturase subunit Fn (mitochondrion) (mitochondrion) [Erythranthe guttata] Length = 577 Score = 60.1 bits (144), Expect = 4e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 133 RSRAMSKRGGHRETLFYSFVSNFVKNSILSLSRY 32 +S +SKRGGHRETLFYSF+SNFVKNSILSL RY Sbjct: 102 KSHNVSKRGGHRETLFYSFLSNFVKNSILSLPRY 135 >gb|AKJ25526.1| cytochrome c maturase subunit Fn (mitochondrion) [Monsonia emarginata] Length = 579 Score = 59.7 bits (143), Expect = 5e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 133 RSRAMSKRGGHRETLFYSFVSNFVKNSILSLSRY 32 +S +SKRGGHRE+LFYSFVSNFVKNSILSL RY Sbjct: 102 KSHNVSKRGGHRESLFYSFVSNFVKNSILSLPRY 135 >gb|AKJ25524.1| cytochrome c maturase subunit Fn (mitochondrion) [Geranium traversii] Length = 579 Score = 59.7 bits (143), Expect = 5e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 133 RSRAMSKRGGHRETLFYSFVSNFVKNSILSLSRY 32 +S +SKRGGHRE+LFYSFVSNFVKNSILSL RY Sbjct: 102 KSHNVSKRGGHRESLFYSFVSNFVKNSILSLPRY 135 >gb|AKJ25523.1| cytochrome c maturase subunit Fn (mitochondrion) [Geranium sanguineum] Length = 579 Score = 59.7 bits (143), Expect = 5e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 133 RSRAMSKRGGHRETLFYSFVSNFVKNSILSLSRY 32 +S +SKRGGHRE+LFYSFVSNFVKNSILSL RY Sbjct: 102 KSHNVSKRGGHRESLFYSFVSNFVKNSILSLPRY 135 >gb|AKJ25518.1| cytochrome c maturase subunit Fn (mitochondrion) [Geranium platypetalum] gi|825716032|gb|AKJ25520.1| cytochrome c maturase subunit Fn (mitochondrion) [Geranium renardii] Length = 579 Score = 59.7 bits (143), Expect = 5e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 133 RSRAMSKRGGHRETLFYSFVSNFVKNSILSLSRY 32 +S +SKRGGHRE+LFYSFVSNFVKNSILSL RY Sbjct: 102 KSHNVSKRGGHRESLFYSFVSNFVKNSILSLPRY 135 >gb|AKJ25517.1| cytochrome c maturase subunit Fn (mitochondrion) [Geranium pratense] Length = 579 Score = 59.7 bits (143), Expect = 5e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 133 RSRAMSKRGGHRETLFYSFVSNFVKNSILSLSRY 32 +S +SKRGGHRE+LFYSFVSNFVKNSILSL RY Sbjct: 102 KSHNVSKRGGHRESLFYSFVSNFVKNSILSLPRY 135 >gb|AKJ25516.1| cytochrome c maturase subunit Fn (mitochondrion) [Geranium phaeum] Length = 579 Score = 59.7 bits (143), Expect = 5e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 133 RSRAMSKRGGHRETLFYSFVSNFVKNSILSLSRY 32 +S +SKRGGHRE+LFYSFVSNFVKNSILSL RY Sbjct: 102 KSHNVSKRGGHRESLFYSFVSNFVKNSILSLPRY 135 >gb|AKJ25515.1| cytochrome c maturase subunit Fn (mitochondrion) [Geranium platyanthum] Length = 577 Score = 59.7 bits (143), Expect = 5e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 133 RSRAMSKRGGHRETLFYSFVSNFVKNSILSLSRY 32 +S +SKRGGHRE+LFYSFVSNFVKNSILSL RY Sbjct: 102 KSHNVSKRGGHRESLFYSFVSNFVKNSILSLPRY 135 >gb|AKJ25514.1| cytochrome c maturase subunit Fn (mitochondrion) [Geranium nodosum] Length = 579 Score = 59.7 bits (143), Expect = 5e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 133 RSRAMSKRGGHRETLFYSFVSNFVKNSILSLSRY 32 +S +SKRGGHRE+LFYSFVSNFVKNSILSL RY Sbjct: 102 KSHNVSKRGGHRESLFYSFVSNFVKNSILSLPRY 135 >gb|AKJ25512.1| cytochrome c maturase subunit Fn (mitochondrion) [Geranium macrorrhizum] Length = 582 Score = 59.7 bits (143), Expect = 5e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 133 RSRAMSKRGGHRETLFYSFVSNFVKNSILSLSRY 32 +S +SKRGGHRE+LFYSFVSNFVKNSILSL RY Sbjct: 102 KSHNVSKRGGHRESLFYSFVSNFVKNSILSLPRY 135 >gb|AKJ25510.1| cytochrome c maturase subunit Fn (mitochondrion) [Geranium endressii] Length = 579 Score = 59.7 bits (143), Expect = 5e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 133 RSRAMSKRGGHRETLFYSFVSNFVKNSILSLSRY 32 +S +SKRGGHRE+LFYSFVSNFVKNSILSL RY Sbjct: 102 KSHNVSKRGGHRESLFYSFVSNFVKNSILSLPRY 135