BLASTX nr result
ID: Forsythia22_contig00020742
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00020742 (283 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011085551.1| PREDICTED: cyclin-B1-2-like [Sesamum indicum] 60 7e-07 ref|XP_011099285.1| PREDICTED: cyclin-B1-2 [Sesamum indicum] 57 4e-06 ref|XP_012852536.1| PREDICTED: cyclin-B1-2-like [Erythranthe gut... 57 6e-06 >ref|XP_011085551.1| PREDICTED: cyclin-B1-2-like [Sesamum indicum] Length = 140 Score = 59.7 bits (143), Expect = 7e-07 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 1/37 (2%) Frame = -1 Query: 109 MESPKTIPL-GRQIDPLRHGIHGVKSDIIESHPLESA 2 M+SPK IPL GR DPLR+GIHGVKSDIIE HPLESA Sbjct: 1 MDSPKMIPLEGRADDPLRYGIHGVKSDIIEPHPLESA 37 >ref|XP_011099285.1| PREDICTED: cyclin-B1-2 [Sesamum indicum] Length = 139 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 1/37 (2%) Frame = -1 Query: 109 MESPKTIPL-GRQIDPLRHGIHGVKSDIIESHPLESA 2 M+S K IPL GR+ DPLR+GIHGVKSDIIE HPLESA Sbjct: 1 MDSEKMIPLEGRRDDPLRYGIHGVKSDIIEPHPLESA 37 >ref|XP_012852536.1| PREDICTED: cyclin-B1-2-like [Erythranthe guttatus] gi|604345805|gb|EYU44302.1| hypothetical protein MIMGU_mgv1a015986mg [Erythranthe guttata] Length = 139 Score = 56.6 bits (135), Expect = 6e-06 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 1/37 (2%) Frame = -1 Query: 109 MESPKTIPL-GRQIDPLRHGIHGVKSDIIESHPLESA 2 M+S KTI L GR+ DPLR+GIHGVKSDIIE HPLESA Sbjct: 1 MDSQKTIQLEGRRDDPLRYGIHGVKSDIIEPHPLESA 37