BLASTX nr result
ID: Forsythia22_contig00020588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00020588 (378 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP13295.1| unnamed protein product [Coffea canephora] 60 4e-07 >emb|CDP13295.1| unnamed protein product [Coffea canephora] Length = 60 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/59 (50%), Positives = 33/59 (55%), Gaps = 2/59 (3%) Frame = -2 Query: 314 MDIYSSEGLSWADQWDPEPLPPAP--EXXXXXXXXXXXXXXXXXXXXKWVKNLCKKSQK 144 MD+Y SEGLSWADQWDPEPLPPA + W+KNL KKSQK Sbjct: 1 MDVYKSEGLSWADQWDPEPLPPASDNDKKKGKDGSNKNKLGKKILTLSWIKNLGKKSQK 59