BLASTX nr result
ID: Forsythia22_contig00019377
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00019377 (621 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012828376.1| PREDICTED: uncharacterized protein LOC105949... 64 8e-08 gb|EYU18535.1| hypothetical protein MIMGU_mgv1a006469mg [Erythra... 64 8e-08 ref|XP_011092382.1| PREDICTED: uncharacterized protein LOC105172... 63 1e-07 ref|XP_009803655.1| PREDICTED: uncharacterized protein LOC104248... 60 9e-07 ref|XP_009613138.1| PREDICTED: uncharacterized protein LOC104106... 58 3e-06 >ref|XP_012828376.1| PREDICTED: uncharacterized protein LOC105949617 isoform X1 [Erythranthe guttatus] Length = 575 Score = 63.5 bits (153), Expect = 8e-08 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -3 Query: 619 GLTEEEISAFYRDVTKHINSKPSLKILLQVQPKFLLPLETQ 497 GLTEEEISAFYRD TK+INSKPSL+IL V+ KFLLP ++Q Sbjct: 518 GLTEEEISAFYRDFTKYINSKPSLRILQGVRLKFLLPFDSQ 558 >gb|EYU18535.1| hypothetical protein MIMGU_mgv1a006469mg [Erythranthe guttata] Length = 443 Score = 63.5 bits (153), Expect = 8e-08 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -3 Query: 619 GLTEEEISAFYRDVTKHINSKPSLKILLQVQPKFLLPLETQ 497 GLTEEEISAFYRD TK+INSKPSL+IL V+ KFLLP ++Q Sbjct: 386 GLTEEEISAFYRDFTKYINSKPSLRILQGVRLKFLLPFDSQ 426 >ref|XP_011092382.1| PREDICTED: uncharacterized protein LOC105172576 [Sesamum indicum] Length = 616 Score = 63.2 bits (152), Expect = 1e-07 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -3 Query: 619 GLTEEEISAFYRDVTKHINSKPSLKILLQVQPKFLLPLET 500 GLT+EEISAF+RDVTK+++SKPSLKIL VQPK LLP ++ Sbjct: 559 GLTDEEISAFFRDVTKYVDSKPSLKILQAVQPKILLPFDS 598 >ref|XP_009803655.1| PREDICTED: uncharacterized protein LOC104248991 [Nicotiana sylvestris] Length = 585 Score = 60.1 bits (144), Expect = 9e-07 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 619 GLTEEEISAFYRDVTKHINSKPSLKILLQVQPKFLLPLET 500 GLTEEEISAFYRDVTK+INSK S K++ VQ +FLLPL + Sbjct: 536 GLTEEEISAFYRDVTKYINSKLSFKVMQGVQSRFLLPLHS 575 >ref|XP_009613138.1| PREDICTED: uncharacterized protein LOC104106321 [Nicotiana tomentosiformis] Length = 613 Score = 58.2 bits (139), Expect = 3e-06 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -3 Query: 619 GLTEEEISAFYRDVTKHINSKPSLKILLQVQPKFLLPLET 500 GLTEEEIS+FYRDVTK+INSK SLK++ VQ F+LPL + Sbjct: 531 GLTEEEISSFYRDVTKYINSKLSLKVMQGVQSGFILPLHS 570