BLASTX nr result
ID: Forsythia22_contig00019006
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00019006 (480 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098112.1| PREDICTED: coiled-coil domain-containing pro... 47 2e-09 >ref|XP_011098112.1| PREDICTED: coiled-coil domain-containing protein 94 isoform X1 [Sesamum indicum] Length = 335 Score = 47.4 bits (111), Expect(2) = 2e-09 Identities = 25/44 (56%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = -1 Query: 480 RRKVSEE-PCNPTDSLTKGTDLDCSNSRDSMQGSGASDSGKFIF 352 +RKV EE P NPTD+LT D SN++D+ SGAS++GKFIF Sbjct: 238 KRKVPEEHPSNPTDALTTAGVGDSSNNQDNAGASGASNNGKFIF 281 Score = 41.2 bits (95), Expect(2) = 2e-09 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 278 QEAGPTTVASSGLQSLCQQYGSDEDD 201 Q+A T V +SGL SLCQQYGSDED+ Sbjct: 310 QDANSTAVTNSGLLSLCQQYGSDEDE 335