BLASTX nr result
ID: Forsythia22_contig00018128
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00018128 (279 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012850199.1| PREDICTED: proteasome subunit beta type-6 [E... 59 1e-06 ref|XP_011094056.1| PREDICTED: proteasome subunit beta type-6-li... 57 6e-06 >ref|XP_012850199.1| PREDICTED: proteasome subunit beta type-6 [Erythranthe guttatus] gi|604313227|gb|EYU26558.1| hypothetical protein MIMGU_mgv1a012922mg [Erythranthe guttata] Length = 236 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 93 MDAKAGDLDAPHSMGTTIIGVTYSGGVVLGA 1 MD +GDLDAPHSMGTTIIGVTY GGVVLGA Sbjct: 1 MDVSSGDLDAPHSMGTTIIGVTYDGGVVLGA 31 >ref|XP_011094056.1| PREDICTED: proteasome subunit beta type-6-like [Sesamum indicum] Length = 236 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 93 MDAKAGDLDAPHSMGTTIIGVTYSGGVVLGA 1 MD +GDL+APHSMGTTIIGVTY+GGVVLGA Sbjct: 1 MDGISGDLNAPHSMGTTIIGVTYNGGVVLGA 31