BLASTX nr result
ID: Forsythia22_contig00017566
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00017566 (520 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588347.1| NADH-ubiquinone oxidoreductase chain [Medica... 74 4e-11 ref|XP_012575066.1| PREDICTED: uncharacterized protein LOC101494... 45 1e-07 gb|KJB09802.1| hypothetical protein B456_001G167800 [Gossypium r... 57 6e-06 >ref|XP_003588347.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] Length = 339 Score = 73.9 bits (180), Expect = 4e-11 Identities = 36/52 (69%), Positives = 38/52 (73%) Frame = -1 Query: 520 ERGGYLAGVVSVVCHEVPMDRGTSEXXXXXXXXXXXXXXLHSIVSYCTVPYQ 365 ERGGY+AGVVSVVCHEVPMD+GTSE LHSIVSYCTVPYQ Sbjct: 199 ERGGYIAGVVSVVCHEVPMDKGTSESSLLGAGSPLPSIPLHSIVSYCTVPYQ 250 >ref|XP_012575066.1| PREDICTED: uncharacterized protein LOC101494761 [Cicer arietinum] Length = 420 Score = 45.1 bits (105), Expect(2) = 1e-07 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = -2 Query: 117 YGIAAFPSEPLGSPVNPHD 61 YGIAAFPSEPLGSP+NPHD Sbjct: 224 YGIAAFPSEPLGSPINPHD 242 Score = 37.0 bits (84), Expect(2) = 1e-07 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 50 EDIRGSSEWGFPCREP 3 EDIRG+SEW FPCREP Sbjct: 245 EDIRGNSEWRFPCREP 260 >gb|KJB09802.1| hypothetical protein B456_001G167800 [Gossypium raimondii] Length = 330 Score = 56.6 bits (135), Expect = 6e-06 Identities = 29/45 (64%), Positives = 31/45 (68%) Frame = -1 Query: 520 ERGGYLAGVVSVVCHEVPMDRGTSEXXXXXXXXXXXXXXLHSIVS 386 +RGGYLAGVVSVVCHEVPMD+GTSE LHSIVS Sbjct: 203 DRGGYLAGVVSVVCHEVPMDKGTSESSLLGAGSPLPSIPLHSIVS 247