BLASTX nr result
ID: Forsythia22_contig00016442
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00016442 (466 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012074065.1| PREDICTED: protein YIPF6 homolog [Jatropha c... 70 4e-10 ref|XP_012857480.1| PREDICTED: protein YIPF6 homolog [Erythranth... 70 5e-10 ref|XP_011079305.1| PREDICTED: protein YIPF6 homolog isoform X2 ... 70 7e-10 ref|XP_011079304.1| PREDICTED: protein YIPF6 homolog isoform X1 ... 70 7e-10 ref|XP_012445864.1| PREDICTED: protein YIPF6 homolog [Gossypium ... 69 1e-09 ref|XP_010489605.1| PREDICTED: protein YIPF6 homolog [Camelina s... 69 1e-09 ref|XP_010467723.1| PREDICTED: protein YIPF6 homolog [Camelina s... 69 1e-09 ref|XP_010414789.1| PREDICTED: protein YIPF6 homolog [Camelina s... 69 1e-09 ref|XP_009799198.1| PREDICTED: protein YIPF6 homolog [Nicotiana ... 69 1e-09 ref|XP_009629486.1| PREDICTED: protein YIPF6 homolog [Nicotiana ... 69 1e-09 ref|XP_006367543.1| PREDICTED: protein YIPF6 homolog [Solanum tu... 69 1e-09 ref|XP_006367542.1| PREDICTED: protein YIPF6 homolog [Solanum tu... 69 1e-09 ref|XP_006298262.1| hypothetical protein CARUB_v10014326mg [Caps... 69 1e-09 ref|XP_004242924.1| PREDICTED: protein YIPF6 homolog [Solanum ly... 69 1e-09 ref|XP_004242923.1| PREDICTED: protein YIPF6 homolog [Solanum ly... 69 1e-09 gb|AAM62630.1| unknown [Arabidopsis thaliana] 69 1e-09 ref|NP_565442.1| Integral membrane Yip1-like protein [Arabidopsi... 69 1e-09 emb|CDP02972.1| unnamed protein product [Coffea canephora] 69 2e-09 emb|CBI17830.3| unnamed protein product [Vitis vinifera] 69 2e-09 ref|XP_002886260.1| integral membrane Yip1 family protein [Arabi... 69 2e-09 >ref|XP_012074065.1| PREDICTED: protein YIPF6 homolog [Jatropha curcas] gi|643728265|gb|KDP36405.1| hypothetical protein JCGZ_08674 [Jatropha curcas] Length = 275 Score = 70.5 bits (171), Expect = 4e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 464 AYPFMSTAVNPRRKALALYPVLLMYVSVGFLIMAIN 357 AYPFMSTAVNPRRKALALYPV LMYVSVGFLI+AIN Sbjct: 240 AYPFMSTAVNPRRKALALYPVFLMYVSVGFLIIAIN 275 >ref|XP_012857480.1| PREDICTED: protein YIPF6 homolog [Erythranthe guttatus] Length = 287 Score = 70.1 bits (170), Expect = 5e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 464 AYPFMSTAVNPRRKALALYPVLLMYVSVGFLIMAIN 357 AYPFMSTAVNPRRKALALYPVLLMYVSVGFLI+AI+ Sbjct: 252 AYPFMSTAVNPRRKALALYPVLLMYVSVGFLIIAID 287 >ref|XP_011079305.1| PREDICTED: protein YIPF6 homolog isoform X2 [Sesamum indicum] Length = 253 Score = 69.7 bits (169), Expect = 7e-10 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -3 Query: 464 AYPFMSTAVNPRRKALALYPVLLMYVSVGFLIMAIN 357 AYPFMSTAVNPRRKALALYPVLLMYVSVGFL++AI+ Sbjct: 218 AYPFMSTAVNPRRKALALYPVLLMYVSVGFLVIAID 253 >ref|XP_011079304.1| PREDICTED: protein YIPF6 homolog isoform X1 [Sesamum indicum] Length = 284 Score = 69.7 bits (169), Expect = 7e-10 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -3 Query: 464 AYPFMSTAVNPRRKALALYPVLLMYVSVGFLIMAIN 357 AYPFMSTAVNPRRKALALYPVLLMYVSVGFL++AI+ Sbjct: 249 AYPFMSTAVNPRRKALALYPVLLMYVSVGFLVIAID 284 >ref|XP_012445864.1| PREDICTED: protein YIPF6 homolog [Gossypium raimondii] gi|763789405|gb|KJB56401.1| hypothetical protein B456_009G118100 [Gossypium raimondii] Length = 282 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 464 AYPFMSTAVNPRRKALALYPVLLMYVSVGFLIMAIN 357 AYPFMS+AVNPRRKALALYPV LMYVSVGFLI+AIN Sbjct: 247 AYPFMSSAVNPRRKALALYPVFLMYVSVGFLIIAIN 282 >ref|XP_010489605.1| PREDICTED: protein YIPF6 homolog [Camelina sativa] Length = 283 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 464 AYPFMSTAVNPRRKALALYPVLLMYVSVGFLIMAIN 357 AYPFMS+AVNPRRKALALYPV LMYVSVGFLI+AIN Sbjct: 248 AYPFMSSAVNPRRKALALYPVFLMYVSVGFLIIAIN 283 >ref|XP_010467723.1| PREDICTED: protein YIPF6 homolog [Camelina sativa] Length = 283 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 464 AYPFMSTAVNPRRKALALYPVLLMYVSVGFLIMAIN 357 AYPFMS+AVNPRRKALALYPV LMYVSVGFLI+AIN Sbjct: 248 AYPFMSSAVNPRRKALALYPVFLMYVSVGFLIIAIN 283 >ref|XP_010414789.1| PREDICTED: protein YIPF6 homolog [Camelina sativa] Length = 283 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 464 AYPFMSTAVNPRRKALALYPVLLMYVSVGFLIMAIN 357 AYPFMS+AVNPRRKALALYPV LMYVSVGFLI+AIN Sbjct: 248 AYPFMSSAVNPRRKALALYPVFLMYVSVGFLIIAIN 283 >ref|XP_009799198.1| PREDICTED: protein YIPF6 homolog [Nicotiana sylvestris] Length = 275 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -3 Query: 464 AYPFMSTAVNPRRKALALYPVLLMYVSVGFLIMAIN 357 AYPFMSTAVNPRRKALALYPV+LMYVSVGFLI+AI+ Sbjct: 240 AYPFMSTAVNPRRKALALYPVVLMYVSVGFLIIAID 275 >ref|XP_009629486.1| PREDICTED: protein YIPF6 homolog [Nicotiana tomentosiformis] Length = 278 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -3 Query: 464 AYPFMSTAVNPRRKALALYPVLLMYVSVGFLIMAIN 357 AYPFMSTAVNPRRKALALYPV+LMYVSVGFLI+AI+ Sbjct: 243 AYPFMSTAVNPRRKALALYPVVLMYVSVGFLIIAID 278 >ref|XP_006367543.1| PREDICTED: protein YIPF6 homolog [Solanum tuberosum] Length = 278 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -3 Query: 464 AYPFMSTAVNPRRKALALYPVLLMYVSVGFLIMAIN 357 AYPFMSTAVNPRRKALALYPV+LMYVSVGFLI+AI+ Sbjct: 243 AYPFMSTAVNPRRKALALYPVVLMYVSVGFLIIAID 278 >ref|XP_006367542.1| PREDICTED: protein YIPF6 homolog [Solanum tuberosum] Length = 278 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -3 Query: 464 AYPFMSTAVNPRRKALALYPVLLMYVSVGFLIMAIN 357 AYPFMSTAVNPRRKALALYPV+LMYVSVGFLI+AI+ Sbjct: 243 AYPFMSTAVNPRRKALALYPVVLMYVSVGFLIIAID 278 >ref|XP_006298262.1| hypothetical protein CARUB_v10014326mg [Capsella rubella] gi|482566971|gb|EOA31160.1| hypothetical protein CARUB_v10014326mg [Capsella rubella] Length = 285 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 464 AYPFMSTAVNPRRKALALYPVLLMYVSVGFLIMAIN 357 AYPFMS+AVNPRRKALALYPV LMYVSVGFLI+AIN Sbjct: 250 AYPFMSSAVNPRRKALALYPVFLMYVSVGFLIIAIN 285 >ref|XP_004242924.1| PREDICTED: protein YIPF6 homolog [Solanum lycopersicum] Length = 278 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -3 Query: 464 AYPFMSTAVNPRRKALALYPVLLMYVSVGFLIMAIN 357 AYPFMSTAVNPRRKALALYPV+LMYVSVGFLI+AI+ Sbjct: 243 AYPFMSTAVNPRRKALALYPVVLMYVSVGFLIIAID 278 >ref|XP_004242923.1| PREDICTED: protein YIPF6 homolog [Solanum lycopersicum] Length = 278 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -3 Query: 464 AYPFMSTAVNPRRKALALYPVLLMYVSVGFLIMAIN 357 AYPFMSTAVNPRRKALALYPV+LMYVSVGFLI+AI+ Sbjct: 243 AYPFMSTAVNPRRKALALYPVVLMYVSVGFLIIAID 278 >gb|AAM62630.1| unknown [Arabidopsis thaliana] Length = 281 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 464 AYPFMSTAVNPRRKALALYPVLLMYVSVGFLIMAIN 357 AYPFMS+AVNPRRKALALYPV LMYVSVGFLI+AIN Sbjct: 246 AYPFMSSAVNPRRKALALYPVFLMYVSVGFLIIAIN 281 >ref|NP_565442.1| Integral membrane Yip1-like protein [Arabidopsis thaliana] gi|4185150|gb|AAD08953.1| expressed protein [Arabidopsis thaliana] gi|20197033|gb|AAM14883.1| expressed protein [Arabidopsis thaliana] gi|87116642|gb|ABD19685.1| At2g18840 [Arabidopsis thaliana] gi|330251718|gb|AEC06812.1| Integral membrane Yip1-like protein [Arabidopsis thaliana] Length = 281 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 464 AYPFMSTAVNPRRKALALYPVLLMYVSVGFLIMAIN 357 AYPFMS+AVNPRRKALALYPV LMYVSVGFLI+AIN Sbjct: 246 AYPFMSSAVNPRRKALALYPVFLMYVSVGFLIIAIN 281 >emb|CDP02972.1| unnamed protein product [Coffea canephora] Length = 274 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 464 AYPFMSTAVNPRRKALALYPVLLMYVSVGFLIMAIN 357 AYPFMSTAVNPRRKALALYPV LMYVSVGFLI+AI+ Sbjct: 239 AYPFMSTAVNPRRKALALYPVFLMYVSVGFLIIAID 274 >emb|CBI17830.3| unnamed protein product [Vitis vinifera] Length = 265 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -3 Query: 464 AYPFMSTAVNPRRKALALYPVLLMYVSVGFLIMAIN 357 AYPFMS+AVNPRRKALALYPVLLMYVSVGFLI+AI+ Sbjct: 230 AYPFMSSAVNPRRKALALYPVLLMYVSVGFLIIAID 265 >ref|XP_002886260.1| integral membrane Yip1 family protein [Arabidopsis lyrata subsp. lyrata] gi|297332100|gb|EFH62519.1| integral membrane Yip1 family protein [Arabidopsis lyrata subsp. lyrata] Length = 278 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -3 Query: 464 AYPFMSTAVNPRRKALALYPVLLMYVSVGFLIMAIN 357 AYPFMS AVNPRRKALALYPV LMYVSVGFLI+AIN Sbjct: 243 AYPFMSAAVNPRRKALALYPVFLMYVSVGFLIIAIN 278