BLASTX nr result
ID: Forsythia22_contig00015909
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00015909 (293 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP03541.1| unnamed protein product [Coffea canephora] 93 8e-17 ref|XP_009769467.1| PREDICTED: RING finger and CHY zinc finger d... 92 1e-16 ref|XP_009587771.1| PREDICTED: RING finger and CHY zinc finger d... 91 4e-16 ref|XP_011079733.1| PREDICTED: RING finger and CHY zinc finger d... 90 5e-16 ref|XP_012833440.1| PREDICTED: RING finger and CHY zinc finger d... 89 1e-15 ref|XP_006352808.1| PREDICTED: RING finger and CHY zinc finger d... 84 4e-14 ref|XP_010323027.1| PREDICTED: RING finger and CHY zinc finger d... 84 5e-14 gb|EPS63129.1| hypothetical protein M569_11656, partial [Genlise... 83 6e-14 ref|XP_010684478.1| PREDICTED: RING finger and CHY zinc finger d... 82 2e-13 ref|XP_011013258.1| PREDICTED: RING finger and CHY zinc finger d... 81 2e-13 ref|XP_011013257.1| PREDICTED: RING finger and CHY zinc finger d... 81 2e-13 ref|XP_009378905.1| PREDICTED: RING finger and CHY zinc finger d... 81 2e-13 ref|XP_009378904.1| PREDICTED: RING finger and CHY zinc finger d... 81 2e-13 ref|XP_002312758.2| zinc finger family protein [Populus trichoca... 81 2e-13 ref|XP_008375844.1| PREDICTED: RING finger and CHY zinc finger d... 81 3e-13 gb|AFK47591.1| unknown [Medicago truncatula] 81 3e-13 ref|XP_003593984.1| RING finger and CHY zinc finger domain-conta... 81 3e-13 ref|XP_003521535.1| PREDICTED: RING finger and CHY zinc finger d... 80 4e-13 ref|XP_010241530.1| PREDICTED: RING finger and CHY zinc finger d... 80 5e-13 ref|XP_007200576.1| hypothetical protein PRUPE_ppa009889mg [Prun... 80 5e-13 >emb|CDP03541.1| unnamed protein product [Coffea canephora] Length = 293 Score = 92.8 bits (229), Expect = 8e-17 Identities = 37/56 (66%), Positives = 43/56 (76%) Frame = -3 Query: 171 PQRKDAEHGGANSSNSISREDFGKSLYGCVHYRRRCKLRAPCCNQIFTCRHCHNEA 4 PQ G S++ +RED+GK+LYGC HYRRRCKLR PCCNQ+FTCRHCHNEA Sbjct: 17 PQENQEAAGDGESTDQPNREDYGKTLYGCEHYRRRCKLRTPCCNQVFTCRHCHNEA 72 >ref|XP_009769467.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Nicotiana sylvestris] Length = 287 Score = 92.0 bits (227), Expect = 1e-16 Identities = 44/67 (65%), Positives = 50/67 (74%), Gaps = 1/67 (1%) Frame = -3 Query: 201 MEEHDVAAVD-PQRKDAEHGGANSSNSISREDFGKSLYGCVHYRRRCKLRAPCCNQIFTC 25 ME+ D V+ P AE N +NS SREDFGK L+GC HYRRRCKLRAPCCN+IFTC Sbjct: 1 MEDGDNFVVNQPPPAPAEQDDHNDNNS-SREDFGKMLHGCEHYRRRCKLRAPCCNEIFTC 59 Query: 24 RHCHNEA 4 RHCHN+A Sbjct: 60 RHCHNDA 66 >ref|XP_009587771.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Nicotiana tomentosiformis] Length = 287 Score = 90.5 bits (223), Expect = 4e-16 Identities = 40/56 (71%), Positives = 44/56 (78%) Frame = -3 Query: 171 PQRKDAEHGGANSSNSISREDFGKSLYGCVHYRRRCKLRAPCCNQIFTCRHCHNEA 4 P AE + +NS SREDFGK LYGC HYRRRCKLRAPCCN+IFTCRHCHN+A Sbjct: 12 PPPAPAEQDDHDDNNS-SREDFGKMLYGCEHYRRRCKLRAPCCNEIFTCRHCHNDA 66 >ref|XP_011079733.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 [Sesamum indicum] Length = 282 Score = 90.1 bits (222), Expect = 5e-16 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 129 NSISREDFGKSLYGCVHYRRRCKLRAPCCNQIFTCRHCHNEAT 1 ++ SR+DFGK LYGC HYRRRCK+RAPCCNQIFTCRHCHNEAT Sbjct: 19 DNTSRQDFGKLLYGCEHYRRRCKIRAPCCNQIFTCRHCHNEAT 61 >ref|XP_012833440.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 [Erythranthe guttatus] gi|604348557|gb|EYU46712.1| hypothetical protein MIMGU_mgv1a011426mg [Erythranthe guttata] Length = 282 Score = 89.0 bits (219), Expect = 1e-15 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = -3 Query: 129 NSISREDFGKSLYGCVHYRRRCKLRAPCCNQIFTCRHCHNEAT 1 N++ REDFGK L+GC HYRRRCK+RAPCC+Q+FTCRHCHNEAT Sbjct: 19 NNVPREDFGKMLHGCEHYRRRCKIRAPCCDQVFTCRHCHNEAT 61 >ref|XP_006352808.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Solanum tuberosum] Length = 229 Score = 84.0 bits (206), Expect = 4e-14 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = -3 Query: 135 SSNSISREDFGKSLYGCVHYRRRCKLRAPCCNQIFTCRHCHNEA 4 + + R+D GK LYGC HYRRRCKLRAPCCN+IFTCRHCHNEA Sbjct: 18 TEEELDRQDVGKLLYGCDHYRRRCKLRAPCCNEIFTCRHCHNEA 61 >ref|XP_010323027.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 [Solanum lycopersicum] Length = 280 Score = 83.6 bits (205), Expect = 5e-14 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -3 Query: 123 ISREDFGKSLYGCVHYRRRCKLRAPCCNQIFTCRHCHNEA 4 + R+D GK LYGC HYRRRCKLRAPCCN+IFTCRHCHNEA Sbjct: 20 LDRQDVGKLLYGCDHYRRRCKLRAPCCNEIFTCRHCHNEA 59 >gb|EPS63129.1| hypothetical protein M569_11656, partial [Genlisea aurea] Length = 143 Score = 83.2 bits (204), Expect = 6e-14 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = -3 Query: 135 SSNSISREDFGKSLYGCVHYRRRCKLRAPCCNQIFTCRHCHNEA 4 + + + REDFGK YGC HYRRRCK+RAPCC++IFTCRHCHNEA Sbjct: 14 TDSCVGREDFGKLSYGCEHYRRRCKIRAPCCDRIFTCRHCHNEA 57 >ref|XP_010684478.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Beta vulgaris subsp. vulgaris] gi|870854130|gb|KMT05935.1| hypothetical protein BVRB_7g164250 [Beta vulgaris subsp. vulgaris] Length = 285 Score = 81.6 bits (200), Expect = 2e-13 Identities = 30/39 (76%), Positives = 37/39 (94%) Frame = -3 Query: 120 SREDFGKSLYGCVHYRRRCKLRAPCCNQIFTCRHCHNEA 4 +REDFGKS +GC HY+RRC++RAPCCN++FTCRHCHNEA Sbjct: 19 NREDFGKSQFGCDHYKRRCRIRAPCCNRVFTCRHCHNEA 57 >ref|XP_011013258.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 isoform X2 [Populus euphratica] Length = 269 Score = 81.3 bits (199), Expect = 2e-13 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -3 Query: 126 SISREDFGKSLYGCVHYRRRCKLRAPCCNQIFTCRHCHNEAT 1 S R DFGK YGC HYRRRC++RAPCCN+IFTCRHCHNEAT Sbjct: 7 SNERLDFGKMGYGCQHYRRRCQIRAPCCNEIFTCRHCHNEAT 48 >ref|XP_011013257.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 isoform X1 [Populus euphratica] Length = 270 Score = 81.3 bits (199), Expect = 2e-13 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -3 Query: 126 SISREDFGKSLYGCVHYRRRCKLRAPCCNQIFTCRHCHNEAT 1 S R DFGK YGC HYRRRC++RAPCCN+IFTCRHCHNEAT Sbjct: 7 SNERLDFGKMGYGCQHYRRRCQIRAPCCNEIFTCRHCHNEAT 48 >ref|XP_009378905.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 isoform X2 [Pyrus x bretschneideri] Length = 238 Score = 81.3 bits (199), Expect = 2e-13 Identities = 32/50 (64%), Positives = 40/50 (80%) Frame = -3 Query: 153 EHGGANSSNSISREDFGKSLYGCVHYRRRCKLRAPCCNQIFTCRHCHNEA 4 E + + +++R+DFGK YGC HYRRRCK+RAPCC+QIF CRHCHNEA Sbjct: 2 EEDSSAAPPTLTRQDFGKMEYGCDHYRRRCKIRAPCCDQIFPCRHCHNEA 51 >ref|XP_009378904.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 isoform X1 [Pyrus x bretschneideri] Length = 272 Score = 81.3 bits (199), Expect = 2e-13 Identities = 32/50 (64%), Positives = 40/50 (80%) Frame = -3 Query: 153 EHGGANSSNSISREDFGKSLYGCVHYRRRCKLRAPCCNQIFTCRHCHNEA 4 E + + +++R+DFGK YGC HYRRRCK+RAPCC+QIF CRHCHNEA Sbjct: 2 EEDSSAAPPTLTRQDFGKMEYGCDHYRRRCKIRAPCCDQIFPCRHCHNEA 51 >ref|XP_002312758.2| zinc finger family protein [Populus trichocarpa] gi|550333576|gb|EEE90125.2| zinc finger family protein [Populus trichocarpa] Length = 269 Score = 81.3 bits (199), Expect = 2e-13 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -3 Query: 126 SISREDFGKSLYGCVHYRRRCKLRAPCCNQIFTCRHCHNEAT 1 S R DFGK YGC HYRRRC++RAPCCN+IFTCRHCHNEAT Sbjct: 7 SNERLDFGKMGYGCQHYRRRCQIRAPCCNEIFTCRHCHNEAT 48 >ref|XP_008375844.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Malus domestica] Length = 272 Score = 80.9 bits (198), Expect = 3e-13 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = -3 Query: 126 SISREDFGKSLYGCVHYRRRCKLRAPCCNQIFTCRHCHNEA 4 +++R+DFGK YGC HYRRRCK+RAPCC+QIF CRHCHNEA Sbjct: 11 TLTRQDFGKMEYGCDHYRRRCKIRAPCCDQIFPCRHCHNEA 51 >gb|AFK47591.1| unknown [Medicago truncatula] Length = 267 Score = 80.9 bits (198), Expect = 3e-13 Identities = 30/44 (68%), Positives = 39/44 (88%) Frame = -3 Query: 132 SNSISREDFGKSLYGCVHYRRRCKLRAPCCNQIFTCRHCHNEAT 1 +++I R DFGK YGC HYRRRC++RAPCCN++++CRHCHNEAT Sbjct: 3 ASAIERLDFGKMGYGCKHYRRRCRIRAPCCNEVYSCRHCHNEAT 46 >ref|XP_003593984.1| RING finger and CHY zinc finger domain-containing protein [Medicago truncatula] gi|355483032|gb|AES64235.1| CHY and CTCHY and RING-type zinc finger protein [Medicago truncatula] Length = 267 Score = 80.9 bits (198), Expect = 3e-13 Identities = 30/44 (68%), Positives = 39/44 (88%) Frame = -3 Query: 132 SNSISREDFGKSLYGCVHYRRRCKLRAPCCNQIFTCRHCHNEAT 1 +++I R DFGK YGC HYRRRC++RAPCCN++++CRHCHNEAT Sbjct: 3 ASAIERLDFGKMGYGCKHYRRRCRIRAPCCNEVYSCRHCHNEAT 46 >ref|XP_003521535.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like isoform X1 [Glycine max] Length = 271 Score = 80.5 bits (197), Expect = 4e-13 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 117 REDFGKSLYGCVHYRRRCKLRAPCCNQIFTCRHCHNEA 4 REDFGK YGC HY+RRCK+RAPCCNQIF CRHCHN+A Sbjct: 8 REDFGKLQYGCEHYKRRCKIRAPCCNQIFPCRHCHNDA 45 >ref|XP_010241530.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 [Nelumbo nucifera] Length = 267 Score = 80.1 bits (196), Expect = 5e-13 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -3 Query: 117 REDFGKSLYGCVHYRRRCKLRAPCCNQIFTCRHCHNEAT 1 R DFGK YGC HYRRRCK+RAPCCN+IF CRHCHNEAT Sbjct: 8 RLDFGKMGYGCEHYRRRCKIRAPCCNEIFPCRHCHNEAT 46 >ref|XP_007200576.1| hypothetical protein PRUPE_ppa009889mg [Prunus persica] gi|462395976|gb|EMJ01775.1| hypothetical protein PRUPE_ppa009889mg [Prunus persica] Length = 273 Score = 80.1 bits (196), Expect = 5e-13 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -3 Query: 120 SREDFGKSLYGCVHYRRRCKLRAPCCNQIFTCRHCHNEA 4 SR+DFGK YGC HYRRRCK+RAPCC+QIF CRHCHNEA Sbjct: 15 SRQDFGKLDYGCDHYRRRCKIRAPCCDQIFPCRHCHNEA 53