BLASTX nr result
ID: Forsythia22_contig00015859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00015859 (270 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012838023.1| PREDICTED: crocetin glucosyltransferase, chl... 62 2e-07 ref|XP_012844386.1| PREDICTED: crocetin glucosyltransferase, chl... 60 6e-07 ref|XP_012849809.1| PREDICTED: crocetin glucosyltransferase, chl... 59 2e-06 >ref|XP_012838023.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Erythranthe guttatus] gi|604332182|gb|EYU36923.1| hypothetical protein MIMGU_mgv1a026563mg [Erythranthe guttata] Length = 459 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -1 Query: 270 GDEDRGKRMRENAGKWRGLAIEAVKEGGSTYNNLKRLL 157 G+ DRGK MR NA KWRGLA+EAVKE GSTYNNL R+L Sbjct: 421 GEGDRGKEMRRNALKWRGLALEAVKENGSTYNNLIRVL 458 >ref|XP_012844386.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Erythranthe guttatus] gi|604320809|gb|EYU31602.1| hypothetical protein MIMGU_mgv1a021119mg [Erythranthe guttata] Length = 461 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 270 GDEDRGKRMRENAGKWRGLAIEAVKEGGSTYNNLKRLLD 154 G+ DRGK MR NA KWRGLA+EAVKE GS+Y NLKR+L+ Sbjct: 423 GEGDRGKEMRRNALKWRGLALEAVKEKGSSYINLKRVLE 461 >ref|XP_012849809.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Erythranthe guttatus] gi|604314094|gb|EYU27002.1| hypothetical protein MIMGU_mgv1a023035mg [Erythranthe guttata] Length = 459 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -1 Query: 270 GDEDRGKRMRENAGKWRGLAIEAVKEGGSTYNNLKRLL 157 G+ +RG+ MR NA KWRGLA+EAVKE GSTYNNL R+L Sbjct: 421 GECERGREMRRNALKWRGLALEAVKENGSTYNNLIRVL 458